2024-05-16 20:11:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_030243029 721 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin domain containing 2 (Cldnd2), transcript variant X4, mRNA. ACCESSION XM_030243029 VERSION XM_030243029.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000073.7) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001635.27-RS_2023_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/05/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..721 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="7" gene 1..721 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="claudin domain containing 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 long SRA read, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 3 samples with support for all annotated introns" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" CDS 157..702 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X3" /protein_id="XP_030098889.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="
MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPVVRRLIGRCCGAQAQRQIRGGVCDYLD"
misc_feature 223..576 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
agaatcgagcaaacacacttctgggggagggtatccatttagaaggctgctaggggagaagattctggaatatctgctgcctcacagagaaccatcctcccttcccccaaccccgcgggctctttgtcgcaggggaccaggctctgcctccttggcatgggggtgaagaagagccttcagactggagggaatttacttaatctcttgagcagcatcctcacagtactgtctactaccaccaactactggacccgacagcaaggggggcacagtggcctatggcaggagtgtacccatggcaaatgctccaacatcccctgccagaacaccgtggcagtgtccgcagcgtgcatggtgttggcagcaaccttcagtattgtagctttggggatcgggataaggattcagtgtcgagaggcagagtcacgacgtagccagaataccattgtcttacttttcctcagcgggttgctgctgctgattgccttggccgtatacacttcaaagaatgcctggaagccagaagtcttcttctcctggtcctactttttcggatggcttctgctttctgcttgccgacatgatcttgcagagcaccgaagccatcagcggattcccgttgtgcgacggttgattggtcggtgttgcggcgcgcaggcgcagagacagatacggggcggagtgtgtgactatctggattaggagcaacctgacccggcca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]