2024-05-15 10:51:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_201638 2625 bp mRNA linear ROD 25-DEC-2023 DEFINITION Mus musculus methyltransferase 14, N6-adenosine-methyltransferase subunit (Mettl14), mRNA. ACCESSION NM_201638 XM_131193 VERSION NM_201638.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 2625) AUTHORS Zheng Y, Zhang Z, Zheng D, Yi P and Wang S. TITLE METTL14 promotes the development of diabetic kidney disease by regulating m6A modification of TUG1 JOURNAL Acta Diabetol 60 (11), 1567-1580 (2023) PUBMED 37428236 REMARK GeneRIF: METTL14 promotes the development of diabetic kidney disease by regulating m[6]A modification of TUG1. REFERENCE 2 (bases 1 to 2625) AUTHORS Kang Q, Zhu X, Ren D, Ky A, MacDougald OA, O'Rourke RW and Rui L. TITLE Adipose METTL14-Elicited N6 -Methyladenosine Promotes Obesity, Insulin Resistance, and NAFLD Through Suppressing beta Adrenergic Signaling and Lipolysis JOURNAL Adv Sci (Weinh) 10 (28), e2301645 (2023) PUBMED 37526326 REMARK GeneRIF: Adipose METTL14-Elicited N[6] -Methyladenosine Promotes Obesity, Insulin Resistance, and NAFLD Through Suppressing beta Adrenergic Signaling and Lipolysis. REFERENCE 3 (bases 1 to 2625) AUTHORS Kobayashi R, Kawabata-Iwakawa R, Terakawa J, Sugiyama M, Morita S, Horii T and Hatada I. TITLE Aberrant activation of estrogen receptor-alpha signaling in Mettl14-deficient uteri impairs embryo implantation JOURNAL FASEB J 37 (8), e23093 (2023) PUBMED 37440278 REMARK GeneRIF: Aberrant activation of estrogen receptor-alpha signaling in Mettl14-deficient uteri impairs embryo implantation. REFERENCE 4 (bases 1 to 2625) AUTHORS Mu M, Li X, Dong L, Wang J, Cai Q, Hu Y, Wang D, Zhao P, Zhang L, Zhang D, Cheng S, Tan L, Wu F, Shi YG, Xu W, Shi Y and Shen H. TITLE METTL14 regulates chromatin bivalent domains in mouse embryonic stem cells JOURNAL Cell Rep 42 (6), 112650 (2023) PUBMED 37314930 REMARK GeneRIF: METTL14 regulates chromatin bivalent domains in mouse embryonic stem cells. Erratum:[Cell Rep. 2023 Sep 6;42(9):113116. PMID: 37676772] REFERENCE 5 (bases 1 to 2625) AUTHORS Gao J, Chen H, Zhang Y, Yu S, Wu Y, Wang Q and Yu Z. TITLE METTL14 knockdown inhibits the pyroptosis in the sepsis-induced acute lung injury through regulating the m6A modification of NLRP3 JOURNAL Exp Lung Res 49 (1), 220-230 (2023) PUBMED 38047519 REMARK GeneRIF: METTL14 knockdown inhibits the pyroptosis in the sepsis-induced acute lung injury through regulating the m6A modification of NLRP3. REFERENCE 6 (bases 1 to 2625) AUTHORS Wang Y, Li Y, Toth JI, Petroski MD, Zhang Z and Zhao JC. TITLE N6-methyladenosine modification destabilizes developmental regulators in embryonic stem cells JOURNAL Nat Cell Biol 16 (2), 191-198 (2014) PUBMED 24394384 REFERENCE 7 (bases 1 to 2625) AUTHORS Okazaki N, Kikuno R, Ohara R, Inamoto S, Koseki H, Hiraoka S, Saga Y, Nagase T, Ohara O and Koga H. TITLE Prediction of the coding sequences of mouse homologues of KIAA gene: III. the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries JOURNAL DNA Res 10 (4), 167-180 (2003) PUBMED 14621295 REFERENCE 8 (bases 1 to 2625) AUTHORS Mu X, Zhao S, Pershad R, Hsieh TF, Scarpa A, Wang SW, White RA, Beremand PD, Thomas TL, Gan L and Klein WH. TITLE Gene expression in the developing mouse retina by EST sequencing and microarray analysis JOURNAL Nucleic Acids Res 29 (24), 4983-4993 (2001) PUBMED 11812828 REFERENCE 9 (bases 1 to 2625) AUTHORS Piao Y, Ko NT, Lim MK and Ko MS. TITLE Construction of long-transcript enriched cDNA libraries from submicrogram amounts of total RNAs by a universal PCR amplification method JOURNAL Genome Res 11 (9), 1553-1558 (2001) PUBMED 11544199 REFERENCE 10 (bases 1 to 2625) AUTHORS Huttenhofer A, Kiefmann M, Meier-Ewert S, O'Brien J, Lehrach H, Bachellerie JP and Brosius J. TITLE RNomics: an experimental approach that identifies 201 candidates for novel, small, non-messenger RNAs in mouse JOURNAL EMBO J 20 (11), 2943-2953 (2001) PUBMED 11387227 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BE448358.1, AK146881.1, BI990545.1 and BM247306.2. On Sep 30, 2009 this sequence version replaced NM_201638.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK146881.1, BC052204.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164142 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-12 BE448358.1 119-130 13-1620 AK146881.1 2-1609 1621-2048 BI990545.1 173-600 2049-2625 BM247306.2 1-577 c FEATURES Location/Qualifiers source 1..2625 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="3" /map="3 53.96 cM" gene 1..2625 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="methyltransferase 14, N6-adenosine-methyltransferase subunit" /db_xref="GeneID:210529" /db_xref="MGI:MGI:2442926" exon 1..229 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" misc_feature 44..46 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="upstream in-frame stop codon" CDS 164..1534 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /EC_number="2.1.1.62" /note="methyltransferase-like protein 14; snoRNA MBII-84; N6-adenosine-methyltransferase subunit METTL14; methyltransferase like 14" /codon_start=1 /product="N6-adenosine-methyltransferase non-catalytic subunit" /protein_id="NP_964000.2" /db_xref="CCDS:CCDS38622.1" /db_xref="GeneID:210529" /db_xref="MGI:MGI:2442926" /translation="
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNSKRKCLDEGETDEDKVEEYKDELEMQQEEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGTHRGGFTPR"
misc_feature 311..388 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 566..571 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5" misc_feature 599..601 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); other site" misc_feature 719..1252 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="Region: MT-A70; pfam05063" /db_xref="CDD:368270" misc_feature 872..877 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5" misc_feature 887..889 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); other site" misc_feature 896..925 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Positively charged region required for RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5" misc_feature 896..898 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); other site" misc_feature 926..937 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5" misc_feature 995..1024 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5" misc_feature 1052..1057 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Positively charged region required for RNA-binding. /evidence=ECO:0000250|UniProtKB:Q9HCE5" misc_feature 1055..1057 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); other site" misc_feature 1085..1099 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5" misc_feature 1340..1531 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1358..1360 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="Interaction with METTL3. /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); other site" misc_feature 1358..1360 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q9HCE5; propagated from UniProtKB/Swiss-Prot (Q3UIK4.1); phosphorylation site" exon 230..318 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 319..406 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 407..487 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 488..575 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 576..666 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 667..808 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 809..901 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 902..1018 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 1019..1229 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" exon 1230..2625 /gene="Mettl14" /gene_synonym="G430022H21Rik; mKIAA1627" /inference="alignment:Splign:2.1.0" ORIGIN
atagcctgtttcaggcgcgccggaaacttcctcctgagggacgtgaaagtctccgggtcagaatctctgcggggcgggacccggtgtttcctggtttggcaggtggatttgcattttggcgggcgcggagtctgtcggggtggtgagcagccgaagctggggcatggatagccgcctgcaggagatccgggagcggcagaagttacggcggcagctcctagctcagcagttgggagctgagagtgcggatagcattggtgctgtgttaaatagcaaagatgaacagagggagattgctgaaaccagagaaacctgcagggcttcctatgatacatctgctccaaactcaaaacggaagtgtctggatgaaggagagactgatgaagacaaagtagaagaatataaggatgaactggaaatgcagcaggaggaagagaatttgccatatgaagaagagatttacaaagattccagtacctttcttaagggaacgcagagcttaaatccccataatgattactgccaacattttgtagacactggacacagacctcagaatttcatcagggatgtaggtttagctgacagatttgaagaataccctaaacttagggaactcatcagactaaaggatgagttaatagctaagtcaaacactcctcccatgtacttacaagcagacatagaagcctttgacatcagagaattgacacccaaatttgatgtgattctcctggagccccctctggaagaatactatagagagactggcatcactgcgaatgagaaatgctggacctgggatgatattatgaagttagaaatcgatgagattgcagcacctcggtcatttatatttctctggtgcggttctggggaaggattggaccttgggagagtatgcttgcgaaagtggggttacagaagatgtgaagatatttgttggattaaaaccaataaaaacaatcctggaaagacaaagactctagatccaaaggcagttttccagagaacaaaggagcattgcctgatggggatcaaaggaaccgtgaagcgaagcacagacggggacttcattcatgctaatgttgacattgacttaattatcacagaagaacctgagattggcaatatagaaaaaccagtagaaatttttcatataatagaacatttttgtcttggtagaagacgccttcatctctttgggagagatagcactatcaggccaggctggctcacagttggaccaacgcttacaaacagtaactacaatgcagaaacatatgcatcgtatttcagtgcccccaactcatacttgaccggatgtacagaggaaatcgagaggcttcgaccgaagtcacctcctcccaagtccaagtctgaccgtgggggtggagctcccagaggtggaggaagggggggaacatctgctggccgtggtcgggaaagaaaccgatccaatttccgaggagagagaggtggctttagggggggccgtggaggcacgcacagaggcggctttactcctcggtagctcttacacttgcatctttatcacagtggagacttgcttcagagctcactcccagcttgtactttgctttagtttctcatgctgccagaaagatcttagccaccccaccccaccccagggactggcagttgtcacagactgagcttttgctcagggtgggtgagtcacgtgtgcgcaacaccccgacctgacttgactgattccagtcaaggctttggcttcctggaaatggctgcgcagaggcttcggcatctcagaggagtggcaggagtgggtgctgtgttccctgtcatggctgcacggcagcaggaggctgggaacccgggtagaacagaattagagaggtggtcactgtgttgggcctttaatgttttcttgttgaaacactaaaaagagaagagtttttccccttacttttaaattctaaaaaataacatgaagtatcatttgagttcccagaactcgggaggggaaatgaaatctcgttcttccagatcagaatctgaggtggttgcagtcgtcagggtaggtaacgggagaggcaggcagagcatgggatatttcaaacaaaaccaagcttatcataatgtaaattagcggctacagatggctcctgaccatgtgtcttcagaagcaagacaaggcatgtatgtctccaggtcggagtgtgaacctgatcttgggctaacctaagataattcagatttcttagcaaaggcaaaaacagatttggggaggggctggtttaaacggttgagaaaataaaatcttgatgatgaggaaatgacaaacatctttaaagttgttactaaagaaaatttaggtaaaagcaattccagaaaacccttacgaatacagcgtggaagaggacctgcagtgtcctttgattagaactatgtggtgcagaagtcgccgcagggctgatgggcagatctcttggctgtgggaagcttcgtgctgttgcctttctacaccttaagtcctatttgatggatttggatatgccagatgagataatgccaatattgttctgggtaactccttttttattttgctataacttttctaataaaaatttaaacctttgaatt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]