2024-05-15 19:26:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_024470 942 bp mRNA linear ROD 16-FEB-2022 DEFINITION Mus musculus killer cell lectin-like receptor subfamily A, member 23 (Klra23), mRNA. ACCESSION NM_024470 XM_003945716 VERSION NM_024470.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 942) AUTHORS Ma BJ, Craveiro Salvado CM and Kane KP. TITLE The activating Ly49W and inhibitory Ly49G NK cell receptors display similar affinities for identical MHC class I ligands JOURNAL Immunogenetics 66 (7-8), 467-477 (2014) PUBMED 24797174 REMARK GeneRIF: The ectodomain of inhibitory Ly49G of the BALB/c mouse strain is highly similar to the Ly49W activating receptor in the nonobese diabetic (NOD) mouse. REFERENCE 2 (bases 1 to 942) AUTHORS Schenkel AR, Kingry LC and Slayden RA. TITLE The ly49 gene family. A brief guide to the nomenclature, genetics, and role in intracellular infection JOURNAL Front Immunol 4, 90 (2013) PUBMED 23596445 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 942) AUTHORS Makrigiannis AP, Pau AT, Saleh A, Winkler-Pickett R, Ortaldo JR and Anderson SK. TITLE Class I MHC-binding characteristics of the 129/J Ly49 repertoire JOURNAL J Immunol 166 (8), 5034-5043 (2001) PUBMED 11290784 REFERENCE 4 (bases 1 to 942) AUTHORS Silver ET, Gong D, Hazes B and Kane KP. TITLE Ly-49W, an activating receptor of nonobese diabetic mice with close homology to the inhibitory receptor Ly-49G, recognizes H-2D(k) and H-2D(d) JOURNAL J Immunol 166 (4), 2333-2341 (2001) PUBMED 11160290 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF074459.1. On Oct 10, 2012 this sequence version replaced XM_003945716.1. ##Evidence-Data-START## Transcript exon combination :: AF074459.1 [ECO:0000332] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..942 /organism="Mus musculus" /mol_type="mRNA" /strain="NOR" /db_xref="taxon:10090" /chromosome="6" /map="6" gene 1..942 /gene="Klra23" /gene_synonym="Ly-49W1; Ly-49W2; Ly49W" /note="killer cell lectin-like receptor subfamily A, member 23" /db_xref="GeneID:79410" /db_xref="MGI:MGI:1930932" CDS 124..930 /gene="Klra23" /gene_synonym="Ly-49W1; Ly-49W2; Ly49W" /note="killer cell lectin-like receptor subfamily A, member 17" /codon_start=1 /product="killer cell lectin-like receptor subfamily A, member 23" /protein_id="NP_077790.1" /db_xref="GeneID:79410" /db_xref="MGI:MGI:1930932" /translation="
MSEQEVTFSAVRFHKSSGLQNRVRLEETGKPQKAGLRVCSVPWQLIVIALGILISLRLVIVSVLVTNIFQNSQQNHELQETLNCHDKCSTTTQSDINLKDELLSSTSIECRPGNDLLESLHKEQNRWYSETKTFSDSSQHTGRGFEKYWFCYGIKCYYFVMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGFSYDNKKKDWVWIDNGPSKLALNTTKYNIRDGLCMSLSKTRLDNGDCGKSYICICGKRLDKFPH"
misc_feature 241..600 /gene="Klra23" /gene_synonym="Ly-49W1; Ly-49W2; Ly49W" /note="Ly49-like protein, N-terminal region; Region: Ly49; pfam08391" /db_xref="CDD:429969" misc_feature 559..906 /gene="Klra23" /gene_synonym="Ly-49W1; Ly-49W2; Ly49W" /note="C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs); Region: CLECT_NK_receptors_like; cd03593" /db_xref="CDD:153063" misc_feature order(721..723,802..804,856..858,862..867) /gene="Klra23" /gene_synonym="Ly-49W1; Ly-49W2; Ly49W" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153063" ORIGIN
gggatacagaccaggaaagacccacattaccccaacagggacatccattccttctacccacctcacttcagaaatcactcaagtacatattttaaaagagaacatactctacatcctcccaagatgagtgagcaggaggtcactttctcagctgtgagattccataagtcttcagggttgcagaaccgggtgaggcttgaggagacagggaagcctcaaaaagctggcctcagagtgtgttcagttccctggcagctcattgtgatagctctcggaatcctcatttcccttcgactggtaattgtctcagtgcttgtgacaaacatttttcagaatagtcaacaaaatcatgaactgcaggaaactctaaactgccacgataagtgcagcaccaccacgcaaagtgacatcaacttgaaggatgaactgctgagttctacatctatagagtgtaggccaggcaatgatcttctggaatccctccacaaggaacagaacagatggtacagtgaaaccaagactttttcagattcctcacagcacacaggcagaggttttgaaaaatattggttctgttatggtataaaatgttattatttcgtcatggacagaaaaacgtggagtggatgtaaacagacctgccagatttccagcttatcccttctgaagatagacaatgaggatgaactgaagttccttcagaacctggctccttcagacatttcctggattggattttcatatgacaataagaaaaaagattgggtatggattgacaatggcccatctaaacttgccttgaacacaacgaaatataatataagagatggattatgtatgtcgttatctaaaacaagactagacaatggggactgtggtaaatcatacatctgtatttgtggtaagagactggataaattccctcattgactctccaacgag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]