2024-05-16 11:11:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_015776 1505 bp mRNA linear ROD 28-NOV-2023 DEFINITION Mus musculus microfibrillar associated protein 5 (Mfap5), transcript variant 1, mRNA. ACCESSION NM_015776 VERSION NM_015776.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1505) AUTHORS Jacob T, Annusver K, Czarnewski P, Dalessandri T, Kalk C, Levra Levron C, Campama Sanz N, Kastriti ME, Mikkola ML, Rendl M, Lichtenberger BM, Donati G, Bjorklund AK and Kasper M. TITLE Molecular and spatial landmarks of early mouse skin development JOURNAL Dev Cell 58 (20), 2140-2162 (2023) PUBMED 37591247 REFERENCE 2 (bases 1 to 1505) AUTHORS Hofling C, Rossner S, Flachmeyer B, Krueger M, Hartig W and Michalski D. TITLE Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5 Exhibit Concomitantly Altered Immunosignals along with Vascular, Extracellular and Cytoskeletal Elements after Experimental Focal Cerebral Ischemia JOURNAL Int J Mol Sci 24 (15), 11893 (2023) PUBMED 37569268 REMARK GeneRIF: Tricellulin, alpha-Catenin and Microfibrillar-Associated Protein 5 Exhibit Concomitantly Altered Immunosignals along with Vascular, Extracellular and Cytoskeletal Elements after Experimental Focal Cerebral Ischemia. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1505) AUTHORS Chen Z, Zhao H, Meng L, Yu S, Liu Z and Xue J. TITLE Microfibril-Associated Glycoprotein-2 Promoted Fracture Healing via Integrin alphavbeta3/PTK2/AKT Signaling JOURNAL Lab Invest 103 (7), 100121 (2023) PUBMED 36934797 REMARK GeneRIF: Microfibril-Associated Glycoprotein-2 Promoted Fracture Healing via Integrin alphavbeta3/PTK2/AKT Signaling. REFERENCE 4 (bases 1 to 1505) AUTHORS Han C, Leonardo TR, Romana-Souza B, Shi J, Keiser S, Yuan H, Altakriti M, Ranzer MJ, Ferri-Borgogno S, Mok SC, Koh TJ, Hong SJ, Chen L and DiPietro LA. TITLE Microfibril-associated protein 5 and the regulation of skin scar formation JOURNAL Sci Rep 13 (1), 8728 (2023) PUBMED 37253753 REMARK GeneRIF: Microfibril-associated protein 5 and the regulation of skin scar formation. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1505) AUTHORS Wu L, Zhou F, Xin W, Li L, Liu L, Yin X, Xu X, Wang Y and Hua Z. TITLE MAGP2 induces tumor progression by enhancing uPAR-mediated cell proliferation JOURNAL Cell Signal 91, 110214 (2022) PUBMED 34915136 REMARK GeneRIF: MAGP2 induces tumor progression by enhancing uPAR-mediated cell proliferation. REFERENCE 6 (bases 1 to 1505) AUTHORS Nehring LC, Miyamoto A, Hein PW, Weinmaster G and Shipley JM. TITLE The extracellular matrix protein MAGP-2 interacts with Jagged1 and induces its shedding from the cell surface JOURNAL J Biol Chem 280 (21), 20349-20355 (2005) PUBMED 15788413 REFERENCE 7 (bases 1 to 1505) AUTHORS Lemaire R, Farina G, Kissin E, Shipley JM, Bona C, Korn JH and Lafyatis R. TITLE Mutant fibrillin 1 from tight skin mice increases extracellular matrix incorporation of microfibril-associated glycoprotein 2 and type I collagen JOURNAL Arthritis Rheum 50 (3), 915-926 (2004) PUBMED 15022335 REMARK GeneRIF: Tight skin fibrillin 1 altered extracellular matrix organization and caused fibrosis by affecting deposition of MAGP-2 or other fibrillin-1-associated proteins. REFERENCE 8 (bases 1 to 1505) AUTHORS Penner AS, Rock MJ, Kielty CM and Shipley JM. TITLE Microfibril-associated glycoprotein-2 interacts with fibrillin-1 and fibrillin-2 suggesting a role for MAGP-2 in elastic fiber assembly JOURNAL J Biol Chem 277 (38), 35044-35049 (2002) PUBMED 12122015 REMARK GeneRIF: interaction with fibrillin-1 and fibrillin-2 suggesting role in elastic fiber assembly REFERENCE 9 (bases 1 to 1505) AUTHORS Shipley JM, Mecham RP, Maus E, Bonadio J, Rosenbloom J, McCarthy RT, Baumann ML, Frankfater C, Segade F and Shapiro SD. TITLE Developmental expression of latent transforming growth factor beta binding protein 2 and its requirement early in mouse development JOURNAL Mol Cell Biol 20 (13), 4879-4887 (2000) PUBMED 10848613 REFERENCE 10 (bases 1 to 1505) AUTHORS Frankfater C, Maus E, Gaal K, Segade F, Copeland NG, Gilbert DJ, Jenkins NA and Shipley JM. TITLE Organization of the mouse microfibril-associated glycoprotein-2 (MAGP-2) gene JOURNAL Mamm Genome 11 (3), 191-195 (2000) PUBMED 10723723 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC155946.7. On Mar 19, 2018 this sequence version replaced NM_015776.2. Transcript Variant: This variant (1) encodes the longer isoform (1). Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF180805.1, AK003479.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849374, SAMN00849375 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-149 AC155946.7 121370-121518 150-209 AC155946.7 122127-122186 210-245 AC155946.7 123134-123169 246-278 AC155946.7 128365-128397 279-311 AC155946.7 128682-128714 312-347 AC155946.7 129679-129714 348-371 AC155946.7 132273-132296 372-459 AC155946.7 133737-133824 460-533 AC155946.7 134573-134646 534-1505 AC155946.7 136105-137076 FEATURES Location/Qualifiers source 1..1505 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="6" /map="6 57.61 cM" gene 1..1505 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="microfibrillar associated protein 5" /db_xref="GeneID:50530" /db_xref="MGI:MGI:1354387" exon 1..149 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" misc_feature 86..88 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="upstream in-frame stop codon" exon 150..209 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" CDS 152..646 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="isoform 1 precursor is encoded by transcript variant 1; microfibril-associated glycoprotein 2" /codon_start=1 /product="microfibrillar-associated protein 5 isoform 1 precursor" /protein_id="NP_056591.1" /db_xref="CCDS:CCDS20496.1" /db_xref="GeneID:50530" /db_xref="MGI:MGI:1354387" /translation="
MLFLGQKALLLVLAISIPSDWLPLGVSGQRGDDVPETFTDDPNLVNDPSTDDTALADITPSTDDLAGDKNATAECRDEKFACTRLYSVHRPVRQCVHQSCFTSLRRMYIINNEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENMNLQRPDGL"
sig_peptide 152..235 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 155..553 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="Microfibril-associated glycoprotein (MAGP); Region: MAGP; pfam05507" /db_xref="CDD:428500" mat_peptide 236..643 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /product="Microfibrillar-associated protein 5. /id=PRO_0000018686" /note="propagated from UniProtKB/Swiss-Prot (Q9QZJ6.1)" misc_feature 239..247 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="propagated from UniProtKB/Swiss-Prot (Q9QZJ6.1); Region: Cell attachment site. /evidence=ECO:0000255" misc_feature 359..361 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q9QZJ6.1); glycosylation site" exon 210..245 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 246..278 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 279..311 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 312..347 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 348..371 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 372..459 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 460..533 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" exon 534..1505 /gene="Mfap5" /gene_synonym="MAGP-2; MFAP-5" /inference="alignment:Splign:2.1.0" ORIGIN
ttagaataggccaaatgtgaagtctttccaagggtgtggctgtgttcatcttattctccagcccaagtagaacagcagagaagcgtgagaaggacggacacactcagcagccagaggccaccggcagacagatcgcagctctgtagacaatatgctgttcttggggcagaaggccttgctgcttgtcttggcaatcagcatcccctctgactggctacccctaggggtcagtggtcaacgcggagatgatgtgcctgagacattcacagacgaccctaatctggtgaacgatccctctacagacgatacagctctggctgatatcacaccttccacagatgacctagctggtgacaaaaatgctactgcagagtgccgggatgagaagtttgcttgtacaagactgtactctgtccatcggccagtcagacagtgtgtgcaccagtcctgcttcaccagtttacggcgcatgtacatcatcaataatgagatctgttcccgactcgtctgtaaagaacatgaagctatgaaagatgagctttgccggcagatggcaggcctgcctccaaggcgacttcggcgctccaactacttccgacttcctccctgtgaaaatatgaatttgcagagacccgatggtctgtgatcaccaaggaagaaagaagaaaatgtggatgaaggaatcgaaaattctttctcctccaacccctgccatctgtcccgtagacatgtatttttaaactaagccctttgcaatgccccggcttcctaccctactctaattttcactggtgctggtaacgtttgtctcattttgcggtactgacaatacattgtctatattgtggcacgggtttgctgatttctggtgttgtagacaagatggataaaggatggccacttgacttagatacattcagctacattcagctcctgcagtagaaaggggctggggtgcgtggctcagttggcagaaaacttacctaacctttaggttaatattttttttaaatggtgctatgaattgatctcagagcctcgtatataatagtcaatgctctatcactaagctatacccctatctcctaagtagataattttaattattaaatatgccagagacaggagcttgccagaggctcgagccacagagcttccttctagaagtttcctaggttaactcctcattgtttacatatcctctgtactcactttcaccatgcttcgtggcttgtcctaaattttgcccagcaagtcttcatgatgggaaggttgtgggtgaggcaagagagatggctcaatggttaagaacactggatgttcttccagaggacctgggttcagttcccagccagcatccacatggtggctcacaatcacccataagtctagttccagaggacctgagatattttctggcatccatgggcactgcatgcatatgtcacacagacatacatgtggaaaacacacataaaaataaatcactttttaaaaggcaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]