2024-05-16 08:23:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_010420 830 bp mRNA linear ROD 05-OCT-2023 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), transcript variant 1, mRNA. ACCESSION NM_010420 VERSION NM_010420.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 830) AUTHORS Gonzalez-Meljem JM, Ivins S, Andoniadou CL, Le Tissier P, Scambler P and Martinez-Barbera JP. TITLE An expression and function analysis of the CXCR4/SDF-1 signalling axis during pituitary gland development JOURNAL PLoS One 18 (2), e0280001 (2023) PUBMED 36800350 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 830) AUTHORS Bando H, Brinkmeier ML, Castinetti F, Fang Q, Lee MS, Saveanu A, Albarel F, Dupuis C, Brue T and Camper SA. TITLE Heterozygous variants in SIX3 and POU1F1 cause pituitary hormone deficiency in mouse and man JOURNAL Hum Mol Genet 32 (3), 367-385 (2023) PUBMED 35951005 REFERENCE 3 (bases 1 to 830) AUTHORS Brinkmeier ML, Bando H, Camarano AC, Fujio S, Yoshimoto K, de Souza FS and Camper SA. TITLE Rathke's cleft-like cysts arise from Isl1 deletion in murine pituitary progenitors JOURNAL J Clin Invest 130 (8), 4501-4515 (2020) PUBMED 32453714 REFERENCE 4 (bases 1 to 830) AUTHORS Cheung LYM and Camper SA. TITLE PROP1-Dependent Retinoic Acid Signaling Regulates Developmental Pituitary Morphogenesis and Hormone Expression JOURNAL Endocrinology 161 (2) (2020) PUBMED 31913463 REFERENCE 5 (bases 1 to 830) AUTHORS Pozzi S, Bowling S, Apps J, Brickman JM, Rodriguez TA and Martinez-Barbera JP. TITLE Genetic Deletion of Hesx1 Promotes Exit from the Pluripotent State and Impairs Developmental Diapause JOURNAL Stem Cell Reports 13 (6), 970-979 (2019) PUBMED 31761678 REMARK GeneRIF: our data provide evidence for a novel role of Hesx1 in the control of self-renewal and maintenance of the undifferentiated state in ESCs and mouse embryos. REFERENCE 6 (bases 1 to 830) AUTHORS Sheng HZ, Zhadanov AB, Mosinger B Jr, Fujii T, Bertuzzi S, Grinberg A, Lee EJ, Huang SP, Mahon KA and Westphal H. TITLE Specification of pituitary cell lineages by the LIM homeobox gene Lhx3 JOURNAL Science 272 (5264), 1004-1007 (1996) PUBMED 8638120 REFERENCE 7 (bases 1 to 830) AUTHORS Hermesz E, Mackem S and Mahon KA. TITLE Rpx: a novel anterior-restricted homeobox gene progressively activated in the prechordal plate, anterior neural plate and Rathke's pouch of the mouse embryo JOURNAL Development 122 (1), 41-52 (1996) PUBMED 8565852 REFERENCE 8 (bases 1 to 830) AUTHORS Thomas PQ, Johnson BV, Rathjen J and Rathjen PD. TITLE Sequence, genomic organization, and expression of the novel homeobox gene Hesx1 JOURNAL J Biol Chem 270 (8), 3869-3875 (1995) PUBMED 7876132 REFERENCE 9 (bases 1 to 830) AUTHORS Webb GC, Thomas PQ, Ford JH and Rathjen PD. TITLE Hesx1, a homeobox gene expressed by murine embryonic stem cells, maps to mouse chromosome 14, bands A3-B JOURNAL Genomics 18 (2), 464-466 (1993) PUBMED 7904583 REFERENCE 10 (bases 1 to 830) AUTHORS Thomas PQ and Rathjen PD. TITLE HES-1, a novel homeobox gene expressed by murine embryonic stem cells, identifies a new class of homeobox genes JOURNAL Nucleic Acids Res 20 (21), 5840 (1992) PUBMED 1360650 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC124603.5. On Sep 25, 2023 this sequence version replaced NM_010420.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X80040.1, AK082831.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164133, SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-204 AC124603.5 115414-115617 205-404 AC124603.5 116113-116312 405-506 AC124603.5 116560-116661 507-830 AC124603.5 116747-117070 FEATURES Location/Qualifiers source 1..830 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="14" /map="14 16.09 cM" gene 1..830 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="homeobox gene expressed in ES cells" /db_xref="GeneID:15209" /db_xref="MGI:MGI:96071" exon 1..204 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /inference="alignment:Splign:2.1.0" CDS 48..605 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="homeobox protein ANF; rathke pouch homeo box; anterior-restricted homeobox protein; homeo box gene expressed in ES cells" /codon_start=1 /product="homeobox expressed in ES cells 1" /protein_id="NP_034550.2" /db_xref="CCDS:CCDS26884.1" /db_xref="GeneID:15209" /db_xref="MGI:MGI:96071" /translation="
MSPSLREGAQLRESKPAPCSFSIESILGLDQKKDCTTSVRPHRPWTDTCGDSEKGGNPPLHAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQFLMAKKPFNPDLLK"
misc_feature 141..254 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="propagated from UniProtKB/Swiss-Prot (Q61658.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(372..386,390..392,441..443,459..461,498..500, 504..509,516..521,525..533,537..542) /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 378..539 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(378..380,387..389,507..509,516..521,528..530) /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 205..404 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /inference="alignment:Splign:2.1.0" exon 405..506 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /inference="alignment:Splign:2.1.0" exon 507..830 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /inference="alignment:Splign:2.1.0" ORIGIN
gcacacgtggggcaggagccctccggcgctgtacgacccagaagagaatgtctcccagccttcgggaaggtgctcagctccgggaaagcaagcccgcgccctgctccttctcaattgagagcattttaggactggaccagaaaaaagattgtacaacgtcagtaagaccccacagaccctggacagacacctgcggtgactcagagaaaggtggcaacccacccctacatgccccagatcttcccagtgagacttcatttccttgtccagtggatcatccaaggccagaagaaagggctccgaaatatgaaaattatttttcagcctccgaaacacgctctttgaaaagagaattgagttggtaccgaggacgaaggccaagaaccgctttcacccagaaccaggtcgaagtattggaaaatgtctttagagtgaactgctaccctggcattgacatcagagaggacctagctcaaaagctgaacttagaggaagacagaatccagatttggttccaaaatcgccgagcaaagatgaaaaggtcccgtagagaatcacagtttctaatggcgaaaaaacccttcaacccagatcttctgaaataggtagaaaattacacatgttggcttctcttccagttgtatagtacagaagaaatcaatggaaattccaagtacttaaaatgttacagttctctcctgtatctaatctagattttgtcattctttctgaaaatactgcaaataattatggttctagaacagtacatttttagttataattaaaacatctttcctatatatttttaataaaaaaattttcagaaatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]