GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-16 02:24:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_007867               1820 bp    mRNA    linear   ROD 29-AUG-2023
DEFINITION  Mus musculus distal-less homeobox 4 (Dlx4), mRNA.
ACCESSION   NM_007867
VERSION     NM_007867.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1820)
  AUTHORS   Qu F, Li W, Xu J, Zhang R, Ke J, Ren X, Meng X, Qin L, Zhang J, Lu
            F, Zhou X, Luo X, Zhang Z, Wang M, Wu G, Pei D, Chen J, Cui G, Suo
            S and Peng G.
  TITLE     Three-dimensional molecular architecture of mouse organogenesis
  JOURNAL   Nat Commun 14 (1), 4599 (2023)
   PUBMED   37524711
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1820)
  AUTHORS   Vanyai HK, Garnham A, May RE, McRae HM, Collin C, Wilcox S, Smyth
            GK, Thomas T and Voss AK.
  TITLE     MOZ directs the distal-less homeobox gene expression program during
            craniofacial development
  JOURNAL   Development 146 (14) (2019)
   PUBMED   31340933
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1820)
  AUTHORS   Johnson JA, Watson JK, Nikolic MZ and Rawlins EL.
  TITLE     Fank1 and Jazf1 promote multiciliated cell differentiation in the
            mouse airway epithelium
  JOURNAL   Biol Open 7 (4) (2018)
   PUBMED   29661797
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1820)
  AUTHORS   Van Otterloo E, Li H, Jones KL and Williams T.
  TITLE     AP-2alpha and AP-2beta cooperatively orchestrate homeobox gene
            expression during branchial arch patterning
  JOURNAL   Development 145 (2) (2018)
   PUBMED   29229773
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1820)
  AUTHORS   Inoue K, Hirose M, Inoue H, Hatanaka Y, Honda A, Hasegawa A,
            Mochida K and Ogura A.
  TITLE     The Rodent-Specific MicroRNA Cluster within the Sfmbt2 Gene Is
            Imprinted and Essential for Placental Development
  JOURNAL   Cell Rep 19 (5), 949-956 (2017)
   PUBMED   28467908
REFERENCE   6  (bases 1 to 1820)
  AUTHORS   Toresson H, Mata de Urquiza A, Fagerstrom C, Perlmann T and
            Campbell K.
  TITLE     Retinoids are produced by glia in the lateral ganglionic eminence
            and regulate striatal neuron differentiation
  JOURNAL   Development 126 (6), 1317-1326 (1999)
   PUBMED   10021349
REFERENCE   7  (bases 1 to 1820)
  AUTHORS   Quinn LM, Johnson BV, Nicholl J, Sutherland GR and Kalionis B.
  TITLE     Isolation and identification of homeobox genes from the human
            placenta including a novel member of the Distal-less family, DLX4
  JOURNAL   Gene 187 (1), 55-61 (1997)
   PUBMED   9073066
REFERENCE   8  (bases 1 to 1820)
  AUTHORS   Nakamura S, Stock DW, Wydner KL, Bollekens JA, Takeshita K, Nagai
            BM, Chiba S, Kitamura T, Freeland TM, Zhao Z, Minowada J, Lawrence
            JB, Weiss KM and Ruddle FH.
  TITLE     Genomic analysis of a new mammalian distal-less gene: Dlx7
  JOURNAL   Genomics 38 (3), 314-324 (1996)
   PUBMED   8975708
REFERENCE   9  (bases 1 to 1820)
  AUTHORS   Weiss KM, Ruddle FH and Bollekens J.
  TITLE     Dlx and other homeobox genes in the morphological development of
            the dentition
  JOURNAL   Connect Tissue Res 32 (1-4), 35-40 (1995)
   PUBMED   7554933
REFERENCE   10 (bases 1 to 1820)
  AUTHORS   Robinson GW, Wray S and Mahon KA.
  TITLE     Spatially restricted expression of a member of a new family of
            murine Distal-less homeobox genes in the developing forebrain
  JOURNAL   New Biol 3 (12), 1183-1194 (1991)
   PUBMED   1687503
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL645850.6.
            
            On Apr 8, 2008 this sequence version replaced NM_007867.3.
            
            Sequence Note: This RefSeq record was created from genomic sequence
            data because no single transcript was available for the full length
            of the gene. The extent of this transcript is supported by
            transcript alignments and orthologous data.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK145123.1, U73329.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849384
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-606               AL645850.6         14840-15445         c
            607-797             AL645850.6         11433-11623         c
            798-1820            AL645850.6         10091-11113         c
FEATURES             Location/Qualifiers
     source          1..1820
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 59.01 cM"
     gene            1..1820
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="distal-less homeobox 4"
                     /db_xref="GeneID:13394"
                     /db_xref="MGI:MGI:94904"
     exon            1..606
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    288..290
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="upstream in-frame stop codon"
     CDS             321..1043
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="homeobox protein DLX-7; distal-less homeo box 7;
                     DII D"
                     /codon_start=1
                     /product="homeobox protein DLX-4"
                     /protein_id="NP_031893.3"
                     /db_xref="CCDS:CCDS25273.1"
                     /db_xref="GeneID:13394"
                     /db_xref="MGI:MGI:94904"
                     /translation="
MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHFGAWYQHRSPDVLALPQMM"
     misc_feature    450..530
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="propagated from UniProtKB/Swiss-Prot (P70436.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(669..683,687..689,738..740,756..758,795..797,
                     801..806,813..818,822..830,834..839)
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    675..836
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(675..677,684..686,804..806,813..818,825..827)
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    843..902
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /note="propagated from UniProtKB/Swiss-Prot (P70436.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            607..797
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /inference="alignment:Splign:2.1.0"
     exon            798..1820
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1791..1796
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
     polyA_site      1820
                     /gene="Dlx4"
                     /gene_synonym="Dlx-4; Dlx7"
ORIGIN      
aacacgaggggtggggggcgggctcagcttgaggtcaccaaggaatagccaatccggggtgtctaagtgggcgggggacccctggggtcccgggaaccgaacccagaggaaaagatggggaagggtaaaaccacggggtaccccaaaaaaccctttcccgggtgcgagttctctgccggaagaggctcagagagacatttttccaggcatctgaagtgtaagagtggcttgctggagctggagactttgaaaggagctggcagaaagagtagacagcgtgcgggccatgacctaggccctgtggcccggcaccggccgcaatgacctctttaccctgtccccttcctgaccgtggtgcctccaacgttgtcttcccggacctcgcccccgccctgtcggtagtggctgcttacccgctcggactatccccgggaaccgcagcttctcccgatttgtcctactcccagtcctacggccacccccggtcctattcccaccctgggccggcaaccccaggagactcctacctgccccgccagcaacaattggtggcgccatctcagccctttcacaggccggctgaacacccgcaggagctcgaagcagaatcagagaagctggcactgtctctggtgccctcccagcagcagtccctgaccaggaagctgcgcaagcccagaaccatctactctagcctgcagctccaacacctgaaccagcgtttccagcacacccaatacctggccctgcccgagagagctcagctggcagcacaactcggactcacccaaacccaggtaaagatctggtttcagaacaaacgctccaaatataagaagctcctgaaacagagctctggggagccggaagaggacttctctgggagacccccctccctgtctccccactctccagccctaccattcatctggggtctacccaaggcagacaccctgccttccagtggctatgacaacagccactttggtgcctggtatcagcatcgctccccagatgtgctggcactgcctcagatgatgtgagtctggagggaggctggtcagacttcagccctcctgtcaagcccaggacccgagcacctgctccccttctgggaggagaggaaaccagctccagatggattttctcagaagacaagacaccgaaggagaaaaagggaaagaatggtgtggaagcctggctctccaaagcagagagttagatcaggggctttggacggccacaatcttgccactccctctccttcaaatgactgcagccccaagcacagccctaggatccaaaccaggaagaaaacaaatattattcctggcctgcaccatgggggcccagacagcccttccaggaacaaaaccagaagtggacacagggtctgtgttgttggccaccatagagtctccgactttcatttactaattactggtggtggcccagtggtagagtgagtgtttaacatgtaaaaggccccagctccaaagcaaaacttgtggacctgtgggcagcttgtgcttctccgctttaaacggctctctagcgccatatctacccattttgaattgatagccatgggcttaatcgtccatataattcaacagtatgtattaagagcctaggcccacgactctccatccttaacacctaacaagttcacctgcacacattgttggaagcccagaaggagaaatgggacaaacagattaccaggatcagtgcaggcatagctcctcgctgttgcctcgatcaaagaaactgctctcaaatcacaagctattaaaatgtatatatgtattaaaaaagaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]