GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-16 08:12:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001424469            1067 bp    mRNA    linear   ROD 25-SEP-2023
DEFINITION  Mus musculus homeobox gene expressed in ES cells (Hesx1),
            transcript variant 2, mRNA.
ACCESSION   NM_001424469 XM_006518570
VERSION     NM_001424469.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1067)
  AUTHORS   Gonzalez-Meljem JM, Ivins S, Andoniadou CL, Le Tissier P, Scambler
            P and Martinez-Barbera JP.
  TITLE     An expression and function analysis of the CXCR4/SDF-1 signalling
            axis during pituitary gland development
  JOURNAL   PLoS One 18 (2), e0280001 (2023)
   PUBMED   36800350
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1067)
  AUTHORS   Bando H, Brinkmeier ML, Castinetti F, Fang Q, Lee MS, Saveanu A,
            Albarel F, Dupuis C, Brue T and Camper SA.
  TITLE     Heterozygous variants in SIX3 and POU1F1 cause pituitary hormone
            deficiency in mouse and man
  JOURNAL   Hum Mol Genet 32 (3), 367-385 (2023)
   PUBMED   35951005
REFERENCE   3  (bases 1 to 1067)
  AUTHORS   Brinkmeier ML, Bando H, Camarano AC, Fujio S, Yoshimoto K, de Souza
            FS and Camper SA.
  TITLE     Rathke's cleft-like cysts arise from Isl1 deletion in murine
            pituitary progenitors
  JOURNAL   J Clin Invest 130 (8), 4501-4515 (2020)
   PUBMED   32453714
REFERENCE   4  (bases 1 to 1067)
  AUTHORS   Cheung LYM and Camper SA.
  TITLE     PROP1-Dependent Retinoic Acid Signaling Regulates Developmental
            Pituitary Morphogenesis and Hormone Expression
  JOURNAL   Endocrinology 161 (2) (2020)
   PUBMED   31913463
REFERENCE   5  (bases 1 to 1067)
  AUTHORS   Pozzi S, Bowling S, Apps J, Brickman JM, Rodriguez TA and
            Martinez-Barbera JP.
  TITLE     Genetic Deletion of Hesx1 Promotes Exit from the Pluripotent State
            and Impairs Developmental Diapause
  JOURNAL   Stem Cell Reports 13 (6), 970-979 (2019)
   PUBMED   31761678
  REMARK    GeneRIF: our data provide evidence for a novel role of Hesx1 in the
            control of self-renewal and maintenance of the undifferentiated
            state in ESCs and mouse embryos.
REFERENCE   6  (bases 1 to 1067)
  AUTHORS   Sheng HZ, Zhadanov AB, Mosinger B Jr, Fujii T, Bertuzzi S, Grinberg
            A, Lee EJ, Huang SP, Mahon KA and Westphal H.
  TITLE     Specification of pituitary cell lineages by the LIM homeobox gene
            Lhx3
  JOURNAL   Science 272 (5264), 1004-1007 (1996)
   PUBMED   8638120
REFERENCE   7  (bases 1 to 1067)
  AUTHORS   Hermesz E, Mackem S and Mahon KA.
  TITLE     Rpx: a novel anterior-restricted homeobox gene progressively
            activated in the prechordal plate, anterior neural plate and
            Rathke's pouch of the mouse embryo
  JOURNAL   Development 122 (1), 41-52 (1996)
   PUBMED   8565852
REFERENCE   8  (bases 1 to 1067)
  AUTHORS   Thomas PQ, Johnson BV, Rathjen J and Rathjen PD.
  TITLE     Sequence, genomic organization, and expression of the novel
            homeobox gene Hesx1
  JOURNAL   J Biol Chem 270 (8), 3869-3875 (1995)
   PUBMED   7876132
REFERENCE   9  (bases 1 to 1067)
  AUTHORS   Webb GC, Thomas PQ, Ford JH and Rathjen PD.
  TITLE     Hesx1, a homeobox gene expressed by murine embryonic stem cells,
            maps to mouse chromosome 14, bands A3-B
  JOURNAL   Genomics 18 (2), 464-466 (1993)
   PUBMED   7904583
REFERENCE   10 (bases 1 to 1067)
  AUTHORS   Thomas PQ and Rathjen PD.
  TITLE     HES-1, a novel homeobox gene expressed by murine embryonic stem
            cells, identifies a new class of homeobox genes
  JOURNAL   Nucleic Acids Res 20 (21), 5840 (1992)
   PUBMED   1360650
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC124603.5.
            
            On Sep 25, 2023 this sequence version replaced XM_006518570.5.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13422597.1355124.1,
                                           SRR7345562.773514.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164133, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-158               AC124603.5         109106-109263
            159-441             AC124603.5         115335-115617
            442-641             AC124603.5         116113-116312
            642-743             AC124603.5         116560-116661
            744-1067            AC124603.5         116747-117070
FEATURES             Location/Qualifiers
     source          1..1067
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14 16.09 cM"
     gene            1..1067
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="homeobox gene expressed in ES cells"
                     /db_xref="GeneID:15209"
                     /db_xref="MGI:MGI:96071"
     exon            1..158
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
     exon            159..441
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    213..215
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="upstream in-frame stop codon"
     CDS             285..842
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="homeobox protein ANF; rathke pouch homeo box;
                     anterior-restricted homeobox protein; homeo box gene
                     expressed in ES cells"
                     /codon_start=1
                     /product="homeobox expressed in ES cells 1"
                     /protein_id="NP_001411398.1"
                     /db_xref="GeneID:15209"
                     /db_xref="MGI:MGI:96071"
                     /translation="
MSPSLREGAQLRESKPAPCSFSIESILGLDQKKDCTTSVRPHRPWTDTCGDSEKGGNPPLHAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQFLMAKKPFNPDLLK"
     misc_feature    378..491
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /note="propagated from UniProtKB/Swiss-Prot (Q61658.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            442..641
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
     exon            642..743
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
     exon            744..1067
                     /gene="Hesx1"
                     /gene_synonym="HES-1; Rpx"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gagattgcgcgggagcaacaagcttttcagatagcaacaaaaaccggtgtggagatctaaagccgggaggtgcgggagggtgtacatagagcattcacgaagaggaggaggagcctgctgtggctataaggtgatgggagaaggcactaggagatgaggattttaattagtgactttggaaacccagccccctagtcagcaaagctacaaggtgaactgctggaagatcccagctctgcacacgtggggcaggagccctccggcgctgtacgacccagaagagaatgtctcccagccttcgggaaggtgctcagctccgggaaagcaagcccgcgccctgctccttctcaattgagagcattttaggactggaccagaaaaaagattgtacaacgtcagtaagaccccacagaccctggacagacacctgcggtgactcagagaaaggtggcaacccacccctacatgccccagatcttcccagtgagacttcatttccttgtccagtggatcatccaaggccagaagaaagggctccgaaatatgaaaattatttttcagcctccgaaacacgctctttgaaaagagaattgagttggtaccgaggacgaaggccaagaaccgctttcacccagaaccaggtcgaagtattggaaaatgtctttagagtgaactgctaccctggcattgacatcagagaggacctagctcaaaagctgaacttagaggaagacagaatccagatttggttccaaaatcgccgagcaaagatgaaaaggtcccgtagagaatcacagtttctaatggcgaaaaaacccttcaacccagatcttctgaaataggtagaaaattacacatgttggcttctcttccagttgtatagtacagaagaaatcaatggaaattccaagtacttaaaatgttacagttctctcctgtatctaatctagattttgtcattctttctgaaaatactgcaaataattatggttctagaacagtacatttttagttataattaaaacatctttcctatatatttttaataaaaaaattttcagaaatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]