2024-05-15 20:29:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001313698 1356 bp mRNA linear ROD 06-DEC-2023 DEFINITION Mus musculus B cell receptor associated protein 31 (Bcap31), transcript variant 2, mRNA. ACCESSION NM_001313698 VERSION NM_001313698.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1356) AUTHORS Zhao B, Sun L, Yuan Q, Hao Z, An F, Zhang W, Zhu X and Wang B. TITLE BAP31 Knockout in Macrophages Affects CD4+T Cell Activation through Upregulation of MHC Class II Molecule JOURNAL Int J Mol Sci 24 (17), 13476 (2023) PUBMED 37686286 REMARK GeneRIF: BAP31 Knockout in Macrophages Affects CD4[+]T Cell Activation through Upregulation of MHC Class II Molecule. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1356) AUTHORS Wei X, Li L, Zhao J, Huo Y, Hu X, Lu J, Pi J, Zhang W, Xu L, Yao Y and Xu J. TITLE BAP31 depletion inhibited adipogenesis, repressed lipolysis and promoted lipid droplets abnormal growth via attenuating Perilipin1 proteasomal degradation JOURNAL Int J Biol Sci 19 (6), 1713-1730 (2023) PUBMED 37063427 REMARK GeneRIF: BAP31 depletion inhibited adipogenesis, repressed lipolysis and promoted lipid droplets abnormal growth via attenuating Perilipin1 proteasomal degradation. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1356) AUTHORS Li G, Jiang X, Liang X, Hou Y, Zang J, Zhu B, Jia C, Niu K, Liu X, Xu X, Jiang R and Wang B. TITLE BAP31 regulates the expression of ICAM-1/VCAM-1 via MyD88/NF-kappaB pathway in acute lung injury mice model JOURNAL Life Sci 313, 121310 (2023) PUBMED 36549351 REMARK GeneRIF: BAP31 regulates the expression of ICAM-1/VCAM-1 via MyD88/NF-kappaB pathway in acute lung injury mice model. REFERENCE 4 (bases 1 to 1356) AUTHORS Li GX, Jiang XH, Zang JN, Zhu BZ, Jia CC, Niu KW, Liu X, Jiang R and Wang B. TITLE B-cell receptor associated protein 31 deficiency decreases the expression of adhesion molecule CD11b/CD18 and PSGL-1 in neutrophils to ameliorate acute lung injury JOURNAL Int J Biochem Cell Biol 152, 106299 (2022) PUBMED 36210579 REMARK GeneRIF: B-cell receptor associated protein 31 deficiency decreases the expression of adhesion molecule CD11b/CD18 and PSGL-1 in neutrophils to ameliorate acute lung injury. REFERENCE 5 (bases 1 to 1356) AUTHORS Yuan Q, Zhao B, Cao YH, Yan JC, Sun LJ, Liu X, Xu Y, Wang XY and Wang B. TITLE BCR-Associated Protein 31 Regulates Macrophages Polarization and Wound Healing Function via Early Growth Response 2/C/EBPbeta and IL-4Ralpha/C/EBPbeta Pathways JOURNAL J Immunol 209 (6), 1059-1070 (2022) PUBMED 36002233 REMARK GeneRIF: BCR-Associated Protein 31 Regulates Macrophages Polarization and Wound Healing Function via Early Growth Response 2/C/EBPbeta and IL-4Ralpha/C/EBPbeta Pathways. REFERENCE 6 (bases 1 to 1356) AUTHORS Pang AL, Taylor HC, Johnson W, Alexander S, Chen Y, Su YA, Li X, Ravindranath N, Dym M, Rennert OM and Chan WY. TITLE Identification of differentially expressed genes in mouse spermatogenesis JOURNAL J Androl 24 (6), 899-911 (2003) PUBMED 14581517 REFERENCE 7 (bases 1 to 1356) AUTHORS Schamel WW, Kuppig S, Becker B, Gimborn K, Hauri HP and Reth M. TITLE A high-molecular-weight complex of membrane proteins BAP29/BAP31 is involved in the retention of membrane-bound IgD in the endoplasmic reticulum JOURNAL Proc Natl Acad Sci U S A 100 (17), 9861-9866 (2003) PUBMED 12886015 REMARK GeneRIF: A high-molecular-weight complex of membrane proteins BAP29/BAP31 is involved in the retention of membrane-bound IgD in the endoplasmic reticulum. REFERENCE 8 (bases 1 to 1356) AUTHORS Bell AW, Ward MA, Blackstock WP, Freeman HN, Choudhary JS, Lewis AP, Chotai D, Fazel A, Gushue JN, Paiement J, Palcy S, Chevet E, Lafreniere-Roula M, Solari R, Thomas DY, Rowley A and Bergeron JJ. TITLE Proteomics characterization of abundant Golgi membrane proteins JOURNAL J Biol Chem 276 (7), 5152-5165 (2001) PUBMED 11042173 REFERENCE 9 (bases 1 to 1356) AUTHORS Adachi T, Schamel WW, Kim KM, Watanabe T, Becker B, Nielsen PJ and Reth M. TITLE The specificity of association of the IgD molecule with the accessory proteins BAP31/BAP29 lies in the IgD transmembrane sequence JOURNAL EMBO J 15 (7), 1534-1541 (1996) PUBMED 8612576 REFERENCE 10 (bases 1 to 1356) AUTHORS Kim KM, Adachi T, Nielsen PJ, Terashima M, Lamers MC, Kohler G and Reth M. TITLE Two new proteins preferentially associated with membrane immunoglobulin D JOURNAL EMBO J 13 (16), 3793-3800 (1994) PUBMED 8070407 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL805924.5. On Dec 6, 2023 this sequence version replaced NM_001313698.1. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1, 2, and 3 all encode the same isoform (a). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR13861890.133063.1, SRR13422591.87700.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164131 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-198 AL805924.5 204553-204750 c 199-334 AL805924.5 201685-201820 c 335-435 AL805924.5 199337-199437 c 436-583 AL805924.5 193889-194036 c 584-719 AL805924.5 176439-176574 c 720-840 AL805924.5 175552-175672 c 841-941 AL805924.5 174729-174829 c 942-1356 AL805924.5 173073-173487 c FEATURES Location/Qualifiers source 1..1356 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 37.38 cM" gene 1..1356 /gene="Bcap31" /gene_synonym="Bap31" /note="B cell receptor associated protein 31" /db_xref="GeneID:27061" /db_xref="MGI:MGI:1350933" exon 1..198 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" misc_feature 69..71 /gene="Bcap31" /gene_synonym="Bap31" /note="upstream in-frame stop codon" exon 199..334 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" CDS 243..980 /gene="Bcap31" /gene_synonym="Bap31" /note="isoform a is encoded by transcript variant 2; accessory protein BAP31; p28; BCR-associated protein 31" /codon_start=1 /product="B-cell receptor-associated protein 31 isoform a" /protein_id="NP_001300627.1" /db_xref="CCDS:CCDS30209.1" /db_xref="GeneID:27061" /db_xref="MGI:MGI:1350933" /translation="
MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREILKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALAMQKQSEGLTKEYDRLLEEHAKLQASVRGPSVKKEE"
misc_feature 243..650 /gene="Bcap31" /gene_synonym="Bap31" /note="B-cell receptor-associated protein 31-like; Region: Bap31; pfam05529" /db_xref="CDD:428511" misc_feature 261..323 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); transmembrane region" misc_feature 372..434 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); transmembrane region" misc_feature 549..611 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); transmembrane region" misc_feature <642..>953 /gene="Bcap31" /gene_synonym="Bap31" /note="DNA double-strand break repair Rad50 ATPase; Region: PRK02224" /db_xref="CDD:179385" misc_feature 732..737 /gene="Bcap31" /gene_synonym="Bap31" /note="Cleavage, by caspase-8. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q61335.4); cleavage site" misc_feature 816..977 /gene="Bcap31" /gene_synonym="Bap31" /note="Bap31/Bap29 cytoplasmic coiled-coil domain; Region: Bap31_Bap29_C; pfam18035" /db_xref="CDD:436226" misc_feature 966..977 /gene="Bcap31" /gene_synonym="Bap31" /note="propagated from UniProtKB/Swiss-Prot (Q61335.4); Region: Di-lysine motif" exon 335..435 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 436..583 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 584..719 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 720..840 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 841..941 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" exon 942..1356 /gene="Bcap31" /gene_synonym="Bap31" /inference="alignment:Splign:2.1.0" ORIGIN
ctttcgccgtgcctcctctgccactagctccccaaacttgggagagaaggctcgaagcacgttggctgtgaggaacaccaccaggccagcgatggctgagggccaggctgtgccagctcctcgggatcgggcagctcgaaggagagtgtaggaggtcacagccacatccaggagtggcttggtcaggttggaataaaggaaacaagctcccatccctctgttggaaccctttaagtcacaggatgagtttgcagtggactacagttgccaccttcctctacgcagaggtctttgctgtgttgcttctctgcattcccttcatttctccaaaaagatggcagaaggtttttaaatcccggctggtggagttggtagtgacctatggcaacactttctttgtggttctcatcgtcatccttgtactgttggttattgatgctgtacgagagatcctgaaatacgatgatgtgacagaaaaggtgaacctccagaacaatccaggtgccatggagcacttccacatgaagcttttccgtgctcagaggaatctctatattgctggcttttccttgctgctgtccttcctgcttagacgcctggtgactctcatctcccagcaggccacactgctggcctccaatgaagcctttaaaaagcaggcagaaagtgccagtgaggcggccaagaaatacatggaggagaatgatcagctaaagaagggagctgccgaggatggagacaagttggatattgggaatactgaaatgaagttagaggagaacaagagcctgaagaatgacctgaggaagctaaaagatgagctggccagcaccaagaaaaaacttgagaaagctgaaaacgaggctctggctatgcagaagcagtctgagggccttaccaaagaatatgaccgcctgctagaagaacatgccaaactgcaggcatcagtacgtggtccctcagtcaagaaggaggagtaaaggcttggtgtttccctgcctgccgctggcttctacctgacccatgcttactgcttccttggagcccagactatccctctggtacttgggtttattccctacttccccaattttcttccatggcttatagatcattattttggcaccattacacatactgctcttataccaaaagggacctgattgttgtttattcagagtacttttgccactgttctgcctggctagggcactttccactcctggaagtgtagaaaagcactggtgacctggcctgcagtttgaacccctttttattttgcaatgtaccctaaaggaggctgctgtgaagcaggtcaactgttttatcctgaggggaataaatgttgttatgtta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]