2024-05-16 07:56:41, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001145406 590 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 3G (Rhox3g), mRNA. ACCESSION NM_001145406 NR_033696 XM_976278 VERSION NM_001145406.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 590) AUTHORS Maclean JA, Bettegowda A, Kim BJ, Lou CH, Yang SM, Bhardwaj A, Shanker S, Hu Z, Fan Y, Eckardt S, McLaughlin KJ, Skoultchi AI and Wilkinson MF. TITLE The rhox homeobox gene cluster is imprinted and selectively targeted for regulation by histone h1 and DNA methylation JOURNAL Mol Cell Biol 31 (6), 1275-1287 (2011) PUBMED 21245380 REFERENCE 2 (bases 1 to 590) AUTHORS MacLean JA 2nd and Wilkinson MF. TITLE The Rhox genes JOURNAL Reproduction 140 (2), 195-213 (2010) PUBMED 20430877 REMARK Review article REFERENCE 3 (bases 1 to 590) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 4 (bases 1 to 590) AUTHORS Hu Z, Shanker S, MacLean JA 2nd, Ackerman SL and Wilkinson MF. TITLE The RHOX5 homeodomain protein mediates transcriptional repression of the netrin-1 receptor gene Unc5c JOURNAL J Biol Chem 283 (7), 3866-3876 (2008) PUBMED 18077458 REFERENCE 5 (bases 1 to 590) AUTHORS Jackson M, Watt AJ, Gautier P, Gilchrist D, Driehaus J, Graham GJ, Keebler J, Prugnolle F, Awadalla P and Forrester LM. TITLE A murine specific expansion of the Rhox cluster involved in embryonic stem cell biology is under natural selection JOURNAL BMC Genomics 7, 212 (2006) PUBMED 16916441 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 590) AUTHORS Wang X and Zhang J. TITLE Remarkable expansions of an X-linked reproductive homeobox gene cluster in rodent evolution JOURNAL Genomics 88 (1), 34-43 (2006) PUBMED 16574372 REFERENCE 7 (bases 1 to 590) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 8 (bases 1 to 590) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 9 (bases 1 to 590) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BC147475.1. On Dec 21, 2012 this sequence version replaced NM_001145406.2. Summary: This gene is a member of the reproductive homeobox X-linked family (Rhox), which forms part of the superfamily of Homeobox transcription factors. Rhox family members are thought to contribute to early embryo development as well as female and male gametogenesis because they are expressed during embryogenesis and in reproductive tissues. In the mouse, this family expanded to form gene clusters categorized into alpha, beta and gamma, depending on chromosomal locations. Rhox3 paralogs are in the alpha cluster and are reported to be more highly expressed in testes compared to ovaries. This protein is missing a portion of the N-terminus compared to other Rhox3 paralogs, so its functional capacity is unclear. [provided by RefSeq, Dec 2012]. ##Evidence-Data-START## Transcript exon combination :: BC147475.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849384, SAMN01766820 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-590 BC147475.1 1-590 FEATURES Location/Qualifiers source 1..590 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="X" /map="X 21.93 cM" gene 1..590 /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /note="reproductive homeobox 3G" /db_xref="GeneID:546294" /db_xref="MGI:MGI:3770313" exon 1..51 /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /inference="alignment:Splign:2.1.0" CDS 36..518 /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /note="reproductive homeobox 3F; reproductive homeobox 3G, pseudogene" /codon_start=1 /product="reproductive homeobox 3G" /protein_id="NP_001138878.1" /db_xref="CCDS:CCDS72366.1" /db_xref="GeneID:546294" /db_xref="MGI:MGI:3770313" /translation="
MDSTQGTKVLPAEEGRNEEDGGQVESALGATAARGRGKEALNGESPAAAGTAGLVEEDRNKEDGGTKGGEKNEQEVREQIPEHVEGESDQAEAPRQVPRRRLHHRFTQWQLDELERIFRMNYFLSLEARKQLARWMGVNEAIVKRWFQKRREQYRWYKRL"
misc_feature 333..503 /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(333..347,351..353,402..404,420..422,459..461, 465..470,477..482,486..494,498..503) /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(339..341,348..350,468..470,477..482,489..491) /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 52..421 /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /inference="alignment:Splign:2.1.0" exon 422..467 /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /inference="alignment:Splign:2.1.0" exon 468..590 /gene="Rhox3g" /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps" /inference="alignment:Splign:2.1.0" ORIGIN
gagcttcaaggtcagtcaacggatgtgagactaaaatggacagcacccaaggtaccaaggttttgccggctgaagagggaagaaatgaggaagatggaggacaggtggagtcggcattgggagccacagccgcaaggggtagaggaaaagaagcattaaatggagagagtcccgccgctgctggcactgcaggccttgtagaggaagacaggaacaaggaagatggtggcaccaagggaggtgagaagaatgagcaggaagtgagggagcagattcctgagcatgttgaaggagagagtgaccaggctgaagcgccaaggcaggtgccacgacgtcgattgcaccatagattcacccagtggcagctggacgaactggagagaattttccggatgaattattttctcagtctagaagcaagaaaacaactggcccgatggatgggtgtgaatgaagccatagtgaagagatggtttcagaagaggagagaacaatacaggtggtataagaggctataaggtctcagaggttctcctcctgcttctcagaacatctttcatgaagactgtggaggaaccctgcagtgcaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]