GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 21:25:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_054327869             551 bp    mRNA    linear   PRI 05-OCT-2023
DEFINITION  PREDICTED: Homo sapiens S100 calcium binding protein G (S100G),
            transcript variant X1, mRNA.
ACCESSION   XM_054327869
VERSION     XM_054327869.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060947) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/02/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..551
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..551
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="S100 calcium binding protein G; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins, and 97% coverage of the annotated genomic
                     feature by RNAseq alignments, including 5 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:795"
                     /db_xref="HGNC:HGNC:1436"
                     /db_xref="MIM:302020"
     CDS             151..390
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /codon_start=1
                     /product="protein S100-G isoform X1"
                     /protein_id="XP_054183844.1"
                     /db_xref="GeneID:795"
                     /db_xref="HGNC:HGNC:1436"
                     /db_xref="MIM:302020"
                     /translation="
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ"
     misc_feature    184..387
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="S-100 domain, which represents the largest family
                     within the superfamily of proteins carrying the Ca-binding
                     EF-hand motif. Note that this S-100 hierarchy contains
                     only S-100 EF-hand domains, other EF-hands have been
                     modeled separately. S100 proteins are...; Region: S-100;
                     cd00213"
                     /db_xref="CDD:238131"
     misc_feature    order(202..204,217..219,226..228,241..246,322..324,
                     328..330,334..336,340..342,346..348,355..357)
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238131"
ORIGIN      
aaactcctctttgattcttctagctgtttcactattgggcaaccaggaaatggcccaatggcactaaaatcctgcagacaaccctcagcacaaaactgtacttcagctttttggtaagtttattttcttcccaatttataagacaccagaatgagtactaaaaagtctcctgaggaactgaagaggatttttgaaaaatatgcagccaaagaaggtgatccagaccagttgtcaaaggatgaactgaagctattgattcaggctgaattccccagtttactcaaaggtccaaacaccctagatgatctctttcaagaactggacaagaatggagatggagaagttagttttgaagaattccaagtattagtaaaaaagatatcccagtgaaggagaaaacaaaatagaaccctgagcactggaggaagagcgcctgtgctgtggtcttatcctatgtggaatcccccaaagtctctggtttaattctttgcaattataataacctggctgtgaggttcagttattattaataaagaaattattagacatac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]