2024-05-19 13:01:47, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_054321498 2166 bp mRNA linear PRI 05-OCT-2023 DEFINITION PREDICTED: Homo sapiens Meis homeobox 3 (MEIS3), transcript variant X4, mRNA. ACCESSION XM_054321498 VERSION XM_054321498.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060943) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/02/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2166 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="19" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..2166 /gene="MEIS3" /gene_synonym="MRG2" /note="Meis homeobox 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 14 ESTs, 137 long SRA reads, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 19 samples with support for all annotated introns" /db_xref="GeneID:56917" /db_xref="HGNC:HGNC:29537" /db_xref="MIM:619443" CDS 379..1719 /gene="MEIS3" /gene_synonym="MRG2" /codon_start=1 /product="homeobox protein Meis3 isoform X3" /protein_id="XP_054177473.1" /db_xref="GeneID:56917" /db_xref="HGNC:HGNC:29537" /db_xref="MIM:619443" /translation="
MCTLCTTMRGSYRRCPWISLSVCLSLCLCHCLLTPLSPSLFPPSQTLPSLPLGPPAHMSGISAWTGSSLPTEAAPGDLEGFKLGGSDTWGPQYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL"
misc_feature 928..1131 /gene="MEIS3" /gene_synonym="MRG2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:435375" misc_feature order(1381..1392,1396..1398,1456..1458,1474..1476, 1513..1515,1519..1524,1531..1536,1540..1548) /gene="MEIS3" /gene_synonym="MRG2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(1384..1386,1393..1395,1522..1524,1531..1536, 1543..1545) /gene="MEIS3" /gene_synonym="MRG2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 1432..1548 /gene="MEIS3" /gene_synonym="MRG2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
atggtgtttctcttgggtgcgcaatcgtgtctgtatggtggtgcggagtgaccctctccggcaacaagtgctcacagcatgagccaggccctgtgctaaatgcctcattcattcattcatccatgtgccaaatgtctcaatcatgcattcattcttgtgcctggtgttgggctgtgtgcatgtgtgtgtgcatgtgtgtgtgtggggggggatttgggtgtgactgacacatgagtgtgcacgtgggttggtgtgtatggctgtgtctacatgtgtggtagattcacgtggcgagtggagtgtgacatgttgttgagacttactctgatgcgcttatctgccaactgtgaaatgaaatagaagacagggaggcttcgtatgtgtactttgtgtacaacaatgcgcggttcctacaggaggtgtccatggatctccctctctgtctgtctctctctctgtctctgtcactgtcttctcacgccactttctccatctcttttccctcccagccagaccctgccgtctctccctctgggtcctcctgcccacatgtcaggaatctctgcctggacggggtcctcactccccaccgaggcagctccaggggacctggagggcttcaagcttgggggctcagacacctggggaccacagtatgatgagctgccgcactacccaggcatcgtggatggccccgcagccctggctagcttcccagagacagtgcccgcagtaccagggccctatggcccgcaccggcctccccagcccctgcccccaggcttggacagcgacggcctgaagagggagaaggatgagatctatggacacccgctcttccccctcttggccctggtctttgagaaatgtgaactggctacatgctctccccgtgacggggccggagctgggctggggacaccccctggaggtgacgtctgctcctctgattccttcaacgaggacatcgctgcctttgccaagcaggttcgctctgagaggcccctcttctcctccaacccagaactggacaatctgatgatccaggccatccaggtgctgcggttccacctgctggagctggagaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacttcgaggactacccagcctcctgccccagcctcccagaccagaataatatgtggattcgagaccatgaggatagtgggtctgtacatttggggaccccaggtccatccagtgggggcctggcctcccagagtggggacaactccagtgaccaaggagacgggctggacaccagcgtggcctctcccagttctggtggagaagatgaggacttggaccaggagcgacggcgaaacaagaagagggggatcttccccaaggtggccaccaacatcatgcgagcctggttgttccagcacctctcgcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcaccatcctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacctatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccatcgggggctataccgagacgcagccacacgtggccgtccggcctccgggatcagtggggatgagtttgaacttggaaggagaatggcattatctatagaggctgatgcaggagagacccagcctccggctgtgacccccagcctcacacctgcctctggttcccgcctggtcctccagcttcaggaccccacctccaaaggcccctctgctcaatgcctacctccctagggccctgctgggacatgggggcctgagtgcccatccaagggctctcaaggacaccggcaaggcctccaggccctgagccccacttctgccttcacctctgcctgggacccgagctgggctcctgggccttggtccccagaagatggcggctagggcctcgccgccaggacagagaagggacggggtggctgggcagtcagggaagtagggtcgcccggatccgacattttggagagattccttcactctcctgtcccccctacctcccttctctaatttcttcttttttttaatgataaagtcttaaaaacacgga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]