GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 16:59:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_054321127             723 bp    mRNA    linear   PRI 05-OCT-2023
DEFINITION  PREDICTED: Homo sapiens divergent-paired related homeobox (DPRX),
            transcript variant X2, mRNA.
ACCESSION   XM_054321127
VERSION     XM_054321127.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060943) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/02/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..723
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..723
                     /gene="DPRX"
                     /note="divergent-paired related homeobox; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 mRNA, 1 EST, 1 Protein, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     3 samples with support for all annotated introns"
                     /db_xref="GeneID:503834"
                     /db_xref="HGNC:HGNC:32166"
                     /db_xref="MIM:611165"
     CDS             122..697
                     /gene="DPRX"
                     /codon_start=1
                     /product="divergent paired-related homeobox isoform X1"
                     /protein_id="XP_054177102.1"
                     /db_xref="GeneID:503834"
                     /db_xref="HGNC:HGNC:32166"
                     /db_xref="MIM:611165"
                     /translation="
MPGSEDLRKGKDQMHSHRKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVPANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSRER"
     misc_feature    order(173..184,188..190,239..241,257..259,296..298,
                     302..307,314..319,323..331,335..340)
                     /gene="DPRX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    176..337
                     /gene="DPRX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(176..178,185..187,305..307,314..319,326..328)
                     /gene="DPRX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      
gccaaagccaaaaggcacaaaccctccagagcccagggagcccgagctacggggacagaaggaacaagaaacattgttcttatccctggacctgaacccaggcgcacatctggattagaagatgccaggctcagaggatcttcgtaaaggcaaggaccagatgcattcacacaggaaacgaaccatgttcactaagaagcaactggaagatctgaacatcttgttcaatgagaacccatacccaaaccccagccttcagaaagaaatggcctcgaaaatagacatacacccaacagtactgcaggtctggttcaagaatcacagagcaaaactcaagaaagcgaaatgcaagcatattcatcaaaaacaagaaactccacaaccgccaataccagagggtggggtctccaccagtgtcggcctgagaaatgcagacacactacccagattgcccaacgctgctcacccgatcggcctggtgtacacgggtcatcgagtcccctcattccagctcatcctgtaccccaacctcaaggtccctgcaaatgacttcattggccacagaatagtccattttggctgctgccgagatcctaatatatactgcctctaccccattttggaatcccaagtttgcgctccaagcttccattctggctctcctgcctgttcatctaaccaaagtcgagagagatgataaatacaaaaagtcacatgttgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]