2024-05-19 16:59:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_054321126 926 bp mRNA linear PRI 05-OCT-2023 DEFINITION PREDICTED: Homo sapiens divergent-paired related homeobox (DPRX), transcript variant X1, mRNA. ACCESSION XM_054321126 VERSION XM_054321126.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060943) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/02/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..926 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="19" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..926 /gene="DPRX" /note="divergent-paired related homeobox; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 EST, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:503834" /db_xref="HGNC:HGNC:32166" /db_xref="MIM:611165" CDS 325..900 /gene="DPRX" /codon_start=1 /product="divergent paired-related homeobox isoform X1" /protein_id="XP_054177101.1" /db_xref="GeneID:503834" /db_xref="HGNC:HGNC:32166" /db_xref="MIM:611165" /translation="
MPGSEDLRKGKDQMHSHRKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVPANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSRER"
misc_feature order(376..387,391..393,442..444,460..462,499..501, 505..510,517..522,526..534,538..543) /gene="DPRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 379..540 /gene="DPRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(379..381,388..390,508..510,517..522,529..531) /gene="DPRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN
tcaagcgatgctcctgccttcatctcctgagtagctgggactacaggcacaccccacactgttagcctgagacagctatagggaaaggtcgcaggaagagtgttgggctcagacacccaagaggcctctttttttccaggaagccactcaccaatcaacatccagactccacattgggcccaggtctcagtggtcatctgcatcatcaggtaaacatgtgcagagatgctgaccagaggagaacaggcaacagggggacctgcaggcaaagcgttaaccttcttatccctggacctgaacccaggcgcacatctggattagaagatgccaggctcagaggatcttcgtaaaggcaaggaccagatgcattcacacaggaaacgaaccatgttcactaagaagcaactggaagatctgaacatcttgttcaatgagaacccatacccaaaccccagccttcagaaagaaatggcctcgaaaatagacatacacccaacagtactgcaggtctggttcaagaatcacagagcaaaactcaagaaagcgaaatgcaagcatattcatcaaaaacaagaaactccacaaccgccaataccagagggtggggtctccaccagtgtcggcctgagaaatgcagacacactacccagattgcccaacgctgctcacccgatcggcctggtgtacacgggtcatcgagtcccctcattccagctcatcctgtaccccaacctcaaggtccctgcaaatgacttcattggccacagaatagtccattttggctgctgccgagatcctaatatatactgcctctaccccattttggaatcccaagtttgcgctccaagcttccattctggctctcctgcctgttcatctaaccaaagtcgagagagatgataaatacaaaaagtcacatgttgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]