2024-05-19 20:06:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_004057 455 bp mRNA linear PRI 25-DEC-2022 DEFINITION Homo sapiens S100 calcium binding protein G (S100G), mRNA. ACCESSION NM_004057 VERSION NM_004057.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 455) AUTHORS Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG, Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF, Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC, Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A, Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG, Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S, Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A, Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S, Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V, Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X, Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S, Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood MA. TITLE A reference map of the human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 455) AUTHORS Fukushima A, Aizaki Y and Sakuma K. TITLE Short-chain fatty acids increase the level of calbindin-D9k messenger RNA in Caco-2 cells JOURNAL J Nutr Sci Vitaminol (Tokyo) 58 (4), 287-291 (2012) PUBMED 23132313 REMARK GeneRIF: Addition of short-chain fatty acids to cultured Caco-2 cells results in elevation of calbindin-D9k mRNA. REFERENCE 3 (bases 1 to 455) AUTHORS Halhali A, Figueras AG, Diaz L, Avila E, Barrera D, Hernandez G and Larrea F. TITLE Effects of calcitriol on calbindins gene expression and lipid peroxidation in human placenta JOURNAL J Steroid Biochem Mol Biol 121 (1-2), 448-451 (2010) PUBMED 20214988 REMARK GeneRIF: cultured syncytiotrophoblast cells express calbindin-D9k and calbindin-D28k genes, which are stimulated by calcitriol REFERENCE 4 (bases 1 to 455) AUTHORS Mao X, Mao Z and Huo Z. TITLE [Effect of parathyroid hormone and 1,25-(OH)2-D3 on the expression of the mRNA of calbindin D9k in Caco-2 cells] JOURNAL Wei Sheng Yan Jiu 36 (3), 372-375 (2007) PUBMED 17712966 REMARK GeneRIF: Parathyroid hormone may inhibit or counteract the increase in CaBP-D9k mRNA caused by 1,25-(OH)2-D3 in Caco-2 cells. REFERENCE 5 (bases 1 to 455) AUTHORS Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J and Bentley DR. TITLE The DNA sequence of the human X chromosome JOURNAL Nature 434 (7031), 325-337 (2005) PUBMED 15772651 REFERENCE 6 (bases 1 to 455) AUTHORS Fleet JC and Hock JM. TITLE Identification of osteocalcin mRNA in nonosteoid tissue of rats and humans by reverse transcription-polymerase chain reaction JOURNAL J Bone Miner Res 9 (10), 1565-1573 (1994) PUBMED 7817802 REFERENCE 7 (bases 1 to 455) AUTHORS Miller EK, Word RA, Goodall CA and Iacopino AM. TITLE Calbindin-D9K gene expression in human myometrium during pregnancy and labor JOURNAL J Clin Endocrinol Metab 79 (2), 609-615 (1994) PUBMED 8045984 REFERENCE 8 (bases 1 to 455) AUTHORS Jeung EB, Krisinger J, Dann JL and Leung PC. TITLE Molecular cloning of the full-length cDNA encoding the human calbindin-D9k JOURNAL FEBS Lett 307 (2), 224-228 (1992) PUBMED 1379540 REFERENCE 9 (bases 1 to 455) AUTHORS Howard A, Legon S, Spurr NK and Walters JR. TITLE Molecular cloning and chromosomal assignment of human calbindin-D9k JOURNAL Biochem Biophys Res Commun 185 (2), 663-669 (1992) PUBMED 1610358 REFERENCE 10 (bases 1 to 455) AUTHORS Balmain N. TITLE Calbindin-D9k. A vitamin-D-dependent, calcium-binding protein in mineralized tissues JOURNAL Clin Orthop Relat Res (265), 265-276 (1991) PUBMED 2009668 REMARK Review article COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from L13220.1 and AL445467.6. On May 17, 2019 this sequence version replaced NM_004057.2. Summary: This gene encodes calbindin D9K, a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vitamin D-dependent and its expression correlates with calcium transport activity. The protein may increase Ca2+ absorption by buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+ transport in duodenal basolateral membrane vesicles. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X65869.1, L13220.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1968189, SAMEA2144835 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## MANE Ensembl match :: ENST00000380200.3/ ENSP00000369547.3 RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-453 L13220.1 4-456 454-455 AL445467.6 52666-52667 FEATURES Location/Qualifiers source 1..455 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" /map="Xp22.2" gene 1..455 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="S100 calcium binding protein G" /db_xref="GeneID:795" /db_xref="HGNC:HGNC:1436" /db_xref="MIM:302020" exon 1..46 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /inference="alignment:Splign:2.1.0" variation 1 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:1323603392" variation 15 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:184900887" variation 18 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1602198051" variation 20 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1932536901" variation 24 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:968535380" variation 25 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:966015126" variation 26 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1932537723" variation 43 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932537958" exon 47..189 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /inference="alignment:Splign:2.1.0" variation 48 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:41311513" variation 51 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1932593597" variation 53 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932593869" CDS 55..294 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="calbindin D9K; calbindin 3, (vitamin D-dependent calcium-binding protein); vitamin D-dependent calcium-binding protein, intestinal; calbindin-D9k" /codon_start=1 /product="protein S100-G" /protein_id="NP_004048.1" /db_xref="CCDS:CCDS14176.1" /db_xref="GeneID:795" /db_xref="HGNC:HGNC:1436" /db_xref="MIM:302020" /translation="
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ"
misc_feature 58..60 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="N-acetylserine. /evidence=ECO:0000250|UniProtKB:P02633; propagated from UniProtKB/Swiss-Prot (P29377.2); acetylation site" misc_feature 88..291 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif. Note that this S-100 hierarchy contains only S-100 EF-hand domains, other EF-hands have been modeled separately. S100 proteins are...; Region: S-100; cd00213" /db_xref="CDD:238131" misc_feature order(106..108,121..123,130..132,145..150,226..228, 232..234,238..240,244..246,250..252,259..261) /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:238131" misc_feature 178..180 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P02634; propagated from UniProtKB/Swiss-Prot (P29377.2); phosphorylation site" variation 56 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1873054823" variation 59 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:541214571" variation 60 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932594486" variation 62 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:369636673" variation 64..68 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="aaaa" /replace="aaaaa" /db_xref="dbSNP:1932595185" variation 69 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:754268491" variation 82 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932595769" variation 83 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:756835549" variation 86 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932596307" variation 89 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1259653281" variation 91 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:778649375" variation 104 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:749870927" variation 111 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1219440510" variation 120 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:757919379" variation 127 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932598140" variation 128 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:867075278" variation 130 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:779597184" variation 132 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:746946039" variation 133..134 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="tt" /replace="ttt" /db_xref="dbSNP:1180547905" variation 133 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932599383" variation 135 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932599922" variation 136 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:192512496" variation 138 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932600504" variation 144 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:1932600743" variation 147 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932601030" variation 148 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932601281" variation 155 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:1932601551" variation 156 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:768623930" variation 157 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1005147530" variation 164 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:1218227629" variation 168 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:780831648" variation 176 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1932603053" variation 177 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:748000340" variation 178 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932603622" variation 182 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:1932603917" variation 189 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:771022384" exon 190..455 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /inference="alignment:Splign:2.1.0" variation 190 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:200041601" variation 191 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:781223162" variation 195 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932770740" variation 197 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932770808" variation 198 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1932770872" variation 201 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932770936" variation 203 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1569213768" variation 204 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932771049" variation 207 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:747833457" variation 210..214 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="tct" /replace="tctct" /db_xref="dbSNP:1453706764" variation 210 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932771152" variation 211 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1271386843" variation 215 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:1330255891" variation 217 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1466975354" variation 219 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932771444" variation 223 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:769642148" variation 234 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:777764213" variation 236 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1932771615" variation 239 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:973472441" variation 240 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:746079606" variation 242 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932771775" variation 244 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:1932771827" variation 248 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:772463175" variation 256 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:199885083" variation 257 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1281081309" variation 260 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:145104796" variation 262 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:1198475981" variation 264 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:375477819" variation 266 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:1602207047" variation 267 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1932772333" variation 269 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:2147270089" variation 270 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932772416" variation 276 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932772470" variation 280 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932772526" variation 286 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:2147270119" variation 290 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:754899349" variation 292 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:777210425" variation 296 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:186822909" variation 297 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:144139570" variation 298 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:773607946" variation 299 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="" /replace="g" /db_xref="dbSNP:1932772772" variation 305..306 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="" /replace="cg" /db_xref="dbSNP:1932772831" variation 306 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1189416703" variation 308 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:1932772956" variation 309 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932773012" variation 311 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932773074" variation 312..313 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="aa" /db_xref="dbSNP:1932773133" variation 313 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:1932773186" variation 314 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1441613927" variation 315 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1932773285" variation 316..317 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="" /replace="attt" /db_xref="dbSNP:1932773362" variation 318 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932773420" variation 321 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1932773479" variation 326 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1427258306" variation 327 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="aa" /db_xref="dbSNP:1932773601" variation 328 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1305712267" variation 329 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932773703" variation 330..331 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="" /replace="aa" /db_xref="dbSNP:1932773770" variation 333..334 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="" /replace="t" /db_xref="dbSNP:1932773827" variation 334 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1414824285" variation 335 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:201526472" variation 336..337 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="" /replace="gc" /db_xref="dbSNP:1932774121" variation 336 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:751032045" variation 337 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:6629164" variation 339..342 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="tg" /replace="tgtg" /db_xref="dbSNP:1932774329" variation 339 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:1932774269" variation 342 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1046332363" variation 347 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:746554928" variation 348 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="g" /replace="t" /db_xref="dbSNP:1357608506" variation 354 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1194778429" variation 360 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1479313410" variation 362 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932774657" variation 375 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:766763716" variation 385 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932774758" variation 394 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932774801" variation 395 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:1932774871" variation 397 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:751909194" variation 407 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="g" /db_xref="dbSNP:1037657083" variation 409 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1002013075" variation 422..423 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="" /replace="ca" /db_xref="dbSNP:1932775061" variation 423 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:756804558" variation 427 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="t" /db_xref="dbSNP:1187784474" variation 433 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /db_xref="dbSNP:1932775182" variation 436..442 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="aaa" /replace="aaagaaa" /db_xref="dbSNP:1206622536" variation 445 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:866874075" variation 447 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="c" /replace="t" /db_xref="dbSNP:1932775338" variation 452 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1271083550" variation 454 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="g" /db_xref="dbSNP:1932775396" variation 455 /gene="S100G" /gene_synonym="CABP; CABP1; CABP9K; CALB3" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1279047828" ORIGIN
aaactcctctttgattcttctagctgtttcactattgggcaaccagacaccagaatgagtactaaaaagtctcctgaggaactgaagaggatttttgaaaaatatgcagccaaagaaggtgatccagaccagttgtcaaaggatgaactgaagctattgattcaggctgaattccccagtttactcaaaggtccaaacaccctagatgatctctttcaagaactggacaagaatggagatggagaagttagttttgaagaattccaagtattagtaaaaaagatatcccagtgaaggagaaaacaaaatagaaccctgagcactggaggaagagcgcctgtgctgtggtcttatcctatgtggaatcccccaaagtctctggtttaattctttgcaattataataacctggctgtgaggttcagttattattaataaagaaattattagacatac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]