2024-05-19 13:01:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001414462 2996 bp mRNA linear PRI 21-FEB-2023 DEFINITION Homo sapiens transmembrane BAX inhibitor motif containing 6 (TMBIM6), transcript variant 3, mRNA. ACCESSION NM_001414462 XM_047429490 VERSION NM_001414462.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2996) AUTHORS Zhang X, Chen Q, He Y, Shi Q, Yin C, Xie Y, Yu H, Bao Y, Wang X, Tang C and Dong Z. TITLE STRIP2 motivates non-small cell lung cancer progression by modulating the TMBIM6 stability through IGF2BP3 dependent JOURNAL J Exp Clin Cancer Res 42 (1), 19 (2023) PUBMED 36639675 REMARK GeneRIF: STRIP2 motivates non-small cell lung cancer progression by modulating the TMBIM6 stability through IGF2BP3 dependent. Publication Status: Online-Only REFERENCE 2 (bases 1 to 2996) AUTHORS Liao Y, Qiu Z and Bai L. TITLE miR-302d-3p regulates the viability, migration and apoptosis of breast cancer cells through regulating the TMBIM6-mediated ERK signaling pathway JOURNAL Mol Med Rep 24 (6) (2021) PUBMED 34651659 REMARK GeneRIF: miR302d3p regulates the viability, migration and apoptosis of breast cancer cells through regulating the TMBIM6mediated ERK signaling pathway. REFERENCE 3 (bases 1 to 2996) AUTHORS Bhattarai KR, Kim HK, Chaudhary M, Ur Rashid MM, Kim J, Kim HR and Chae HJ. TITLE TMBIM6 regulates redox-associated posttranslational modifications of IRE1alpha and ER stress response failure in aging mice and humans JOURNAL Redox Biol 47, 102128 (2021) PUBMED 34562874 REMARK GeneRIF: TMBIM6 regulates redox-associated posttranslational modifications of IRE1alpha and ER stress response failure in aging mice and humans. REFERENCE 4 (bases 1 to 2996) AUTHORS Chang X, Zhang T, Meng Q, ShiyuanWang, Yan P, Wang X, Luo D, Zhou X and Ji R. TITLE Quercetin Improves Cardiomyocyte Vulnerability to Hypoxia by Regulating SIRT1/TMBIM6-Related Mitophagy and Endoplasmic Reticulum Stress JOURNAL Oxid Med Cell Longev 2021, 5529913 (2021) PUBMED 33859776 REMARK GeneRIF: Quercetin Improves Cardiomyocyte Vulnerability to Hypoxia by Regulating SIRT1/TMBIM6-Related Mitophagy and Endoplasmic Reticulum Stress. Publication Status: Online-Only REFERENCE 5 (bases 1 to 2996) AUTHORS Han Q, Wang J, Luo H, Li L, Lu X, Liu A, Deng Y and Jiang Y. TITLE TMBIM6, a potential virus target protein identified by integrated multiomics data analysis in SARS-CoV-2-infected host cells JOURNAL Aging (Albany NY) 13 (7), 9160-9185 (2021) PUBMED 33744846 REMARK GeneRIF: TMBIM6, a potential virus target protein identified by integrated multiomics data analysis in SARS-CoV-2-infected host cells. REFERENCE 6 (bases 1 to 2996) AUTHORS Grzmil M, Thelen P, Hemmerlein B, Schweyer S, Voigt S, Mury D and Burfeind P. TITLE Bax inhibitor-1 is overexpressed in prostate cancer and its specific down-regulation by RNA interference leads to cell death in human prostate carcinoma cells JOURNAL Am J Pathol 163 (2), 543-552 (2003) PUBMED 12875974 REMARK GeneRIF: Results indicate that the human Bax inhibitor-1 gene may serve as a prostate cancer expression marker based on its overexpression in prostate carcinoma and prostate cancer cell lines. REFERENCE 7 (bases 1 to 2996) AUTHORS Jean JC, Oakes SM and Joyce-Brady M. TITLE The Bax inhibitor-1 gene is differentially regulated in adult testis and developing lung by two alternative TATA-less promoters JOURNAL Genomics 57 (2), 201-208 (1999) PUBMED 10198159 REFERENCE 8 (bases 1 to 2996) AUTHORS Cowling RT and Birnboim HC. TITLE Preliminary characterization of the protein encoded by human testis-enhanced gene transcript (TEGT) JOURNAL Mol Membr Biol 15 (4), 177-187 (1998) PUBMED 10087504 REFERENCE 9 (bases 1 to 2996) AUTHORS Xu Q and Reed JC. TITLE Bax inhibitor-1, a mammalian apoptosis suppressor identified by functional screening in yeast JOURNAL Mol Cell 1 (3), 337-346 (1998) PUBMED 9660918 REFERENCE 10 (bases 1 to 2996) AUTHORS Walter L, Marynen P, Szpirer J, Levan G and Gunther E. TITLE Identification of a novel conserved human gene, TEGT JOURNAL Genomics 28 (2), 301-304 (1995) PUBMED 8530040 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC084037.35 and AC131157.4. On Feb 21, 2023 this sequence version replaced XM_047429490.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR14038193.1538106.1, SRR11853567.7018.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1965299, SAMEA1966682 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-55 AC084037.35 28819-28873 56-214 AC084037.35 29219-29377 215-300 AC084037.35 39726-39811 301-409 AC084037.35 40235-40343 410-530 AC084037.35 42897-43017 531-579 AC084037.35 45489-45537 580-677 AC084037.35 45645-45742 678-757 AC084037.35 45945-46024 758-858 AC084037.35 46483-46583 859-934 AC131157.4 3177-3252 935-2996 AC131157.4 4346-6407 FEATURES Location/Qualifiers source 1..2996 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="12" /map="12q13.12" gene 1..2996 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="transmembrane BAX inhibitor motif containing 6" /db_xref="GeneID:7009" /db_xref="HGNC:HGNC:11723" /db_xref="MIM:600748" exon 1..55 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 56..214 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" misc_feature 179..181 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="upstream in-frame stop codon" exon 215..300 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" CDS 245..958 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="isoform 1 is encoded by transcript variant 3; BAX inhibitor 1; testis-enhanced gene transcript protein; transmembrane BAX inhibitor motif-containing protein 6; testis enhanced gene transcript" /codon_start=1 /product="bax inhibitor 1 isoform 1" /protein_id="NP_001401391.1" /db_xref="GeneID:7009" /db_xref="HGNC:HGNC:11723" /db_xref="MIM:600748" /translation="
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK"
misc_feature 290..928 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="BAX inhibitor (BI)-1; Region: BI-1; cd10430" /db_xref="CDD:198412" misc_feature 332..394 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="propagated from UniProtKB/Swiss-Prot (P55061.2); transmembrane region" misc_feature 401..463 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="propagated from UniProtKB/Swiss-Prot (P55061.2); transmembrane region" misc_feature 503..565 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="propagated from UniProtKB/Swiss-Prot (P55061.2); transmembrane region" misc_feature 581..643 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="propagated from UniProtKB/Swiss-Prot (P55061.2); transmembrane region" misc_feature 662..724 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="propagated from UniProtKB/Swiss-Prot (P55061.2); transmembrane region" misc_feature 743..805 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="propagated from UniProtKB/Swiss-Prot (P55061.2); transmembrane region" exon 301..409 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 410..530 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 531..579 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 580..677 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 678..757 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 758..858 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 859..934 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" exon 935..2996 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /inference="alignment:Splign:2.1.0" regulatory 1049..1054 /regulatory_class="polyA_signal_sequence" /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="hexamer: AATGAA" polyA_site 1067 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="major polyA site" regulatory 2938..2943 /regulatory_class="polyA_signal_sequence" /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="hexamer: AATATA" regulatory 2973..2978 /regulatory_class="polyA_signal_sequence" /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="hexamer: AATAAA" polyA_site 2974 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="major polyA site" polyA_site 2996 /gene="TMBIM6" /gene_synonym="BAXI1; BI-1; TEGT" /note="major polyA site" ORIGIN
agagcacatccggtgttagaagcgctggtaggccttggagaggcgggttaggaagacgcagggccccttggcctagcttcgatcgttcgaattcagagcacgtccttccgaggtgaaggaacgcgaaactccacccatccgattgctgttcggctgcgggcgggtcctttggtcgggctgaccctgggtgagcggcccggagccaagactcgagagtggagactgctgcacggactctggaaccatgaacatatttgatcgaaagatcaactttgatgcgcttttaaaattttctcatataaccccgtcaacgcagcagcacctgaagaaggtctatgcaagttttgccctttgtatgtttgtggcggctgcaggggcctatgtccatatggtcactcatttcattcaggctggcctgctgtctgccttgggctccctgatattgatgatttggctgatggcaacacctcatagccatgaaactgaacagaaaagactgggacttcttgctggatttgcattccttacaggagttggcctgggccctgccctggagttttgtattgctgtcaaccccagcatccttcccactgctttcatgggcacggcaatgatctttacctgcttcaccctcagtgcactctatgccaggcgccgtagctacctctttctgggaggtatcttgatgtcagccctgagcttgttgcttttgtcttccctggggaatgttttctttggatccatttggcttttccaggcaaacctgtatgtgggactggtggtcatgtgtggcttcgtcctttttgatactcaactcattattgaaaaggccgaacatggagatcaagattatatctggcactgcattgatctcttcttagatttcattactgtcttcagaaaactcatgatgatcctggccatgaatgaaaaggataagaagaaagagaagaaatgaagtgaccatccagcctttcccaattagacttcctctccttccacccctcatttcctttttgcacacattacaggtggtgtgttctgtgataatgaaaagcatcagaaaagcttttgtactttgtggtttcctctattttgaattttttgatcaaaaaactgattagcagaatatagtttggagtttggcttcatcttcctggggttcccctcactcccttttttgtcaaccccatctgtagcctcttcctctactcaggcagtcgacccgccacgatgagaagtgggaccagcagagggcgccaacttcaggagtccgctttcccaccaggcttcattcacccagtggacctgaactgtttggtagagccacccggcccttccttcctcattgttgtttggtatgcgcacagttcctgtgggactgggccgtgagttttccattggaaagaagttcagtggtcccattgttaactcagcctcaaatctcaactgtcaggccctacaaagaaaatggagagcctcttctggtggatgctttgctccctctgagctgcccatgctggtctggcaaacacacctttctgctttgccttcacaaaagtaatgtgttccctttcccaccccttgcctgaccctcagggagtcagcctgcttccatccatgggtgggaagacttcagcacaaaggaaagactaattcttgtcaggcatttttgaaaaggctgattatgtgtatcaaggtacagcatcgtagggttcccctaaacttgccctgtttttgtttttttagtttgttatccccttactgagcggcctctactaggtggctgtgattaaatgtcccaagcaaggatagggaaggggaatggttgagcctctggagatcattgtaaccaatcctgccagacctgtttggggcagtggggagcaaacctagataaggacctgtttggggcagcagggagcaaaatctcctttaacaaccaagcagttcctcattcacatcaacagagcgaggctgtgataacttaggaggcagcaatcctaatagtccttcagtgcattttagtctgtctccaactggacaccagtaggtagtgtcaagccagagattcggggcagtagataaatgttcattttactgatgcactttagtttttggtctgttacctgttttccagaaatttgtggccttttaggcgggagttaggcgaccaaaccagtgagagccccaatccctgcagttttgtggcttcaagtgtgggtggacagtcctaatggggatctccagctccttcctgtgggctgccacagacagctacccccagaagggtcaatgttgggagtggttgtggctctgagctgctctacagagcttcagtgtgagaggatcgagccattgaaagctcattaccagtaggacataatttttggctctccctattcacaaccagtgcacagtttgacacagtggcctcaggttcacagtgcaccatgtcactgtgctatcctacgaaatcatttgtttctaagttgtgtttattcctggagtgacatgccaccccgaatggctcactttcactgaggatgctgtcctctgatttagctgctgcctccagcctctggcttgagaacttactaaaggcacttccttcctgttaaacccctgttaactctccataaatttggtgattctctgctaggcctaagattttgagttaacatctcttgaagccaaactccaccttctgtgctttttgcttgggataatggagtttttctttagaaacagtgccaagaatgacaagatattaaaaaaaaaaaagaaagaaaaaaaaaaaaacacctacttttaaagaaaatacctaacagatttttaatatagttatctctaccactttcttttctagtttcttgattttcagctcaggctgcattctaactcatactgtgaagacaaaggtgtttttgattcagaaatatatgaaatctgcatagtcttaatttgtaaaaaataaagaaaattccttaaccttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]