2024-05-18 17:22:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_205488 1326 bp mRNA linear VRT 23-SEP-2023 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.3 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1326) AUTHORS Yamagishi T, Narematsu M and Nakajima Y. TITLE Msx1 upregulates p27 expression to control cellular proliferation during valvuloseptal endocardial cushion formation in the chick embryonic heart JOURNAL Anat Rec (Hoboken) 304 (8), 1732-1744 (2021) PUBMED 33191650 REMARK GeneRIF: Msx1 upregulates p27 expression to control cellular proliferation during valvuloseptal endocardial cushion formation in the chick embryonic heart. REFERENCE 2 (bases 1 to 1326) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 3 (bases 1 to 1326) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1326) AUTHORS Misra K and Matise MP. TITLE A critical role for sFRP proteins in maintaining caudal neural tube closure in mice via inhibition of BMP signaling JOURNAL Dev Biol 337 (1), 74-83 (2010) PUBMED 19850029 REFERENCE 5 (bases 1 to 1326) AUTHORS Kuraku S, Usuda R and Kuratani S. TITLE Comprehensive survey of carapacial ridge-specific genes in turtle implies co-option of some regulatory genes in carapace evolution JOURNAL Evol Dev 7 (1), 3-17 (2005) PUBMED 15642085 REFERENCE 6 (bases 1 to 1326) AUTHORS Coelho CN, Sumoy L, Kosher RA and Upholt WB. TITLE GHox-7: a chicken homeobox-containing gene expressed in a fashion consistent with a role in patterning events during embryonic chick limb development JOURNAL Differentiation 49 (2), 85-92 (1992) PUBMED 1350765 REFERENCE 7 (bases 1 to 1326) AUTHORS Nohno T, Noji S, Koyama E, Nishikawa K, Myokai F, Saito T and Taniguchi S. TITLE Differential expression of two msh-related homeobox genes Chox-7 and Chox-8 during chick limb development JOURNAL Biochem Biophys Res Commun 182 (1), 121-128 (1992) PUBMED 1346246 REFERENCE 8 (bases 1 to 1326) AUTHORS Robert B, Lyons G, Simandl BK, Kuroiwa A and Buckingham M. TITLE The apical ectodermal ridge regulates Hox-7 and Hox-8 gene expression in developing chick limb buds JOURNAL Genes Dev 5 (12B), 2363-2374 (1991) PUBMED 1684333 REFERENCE 9 (bases 1 to 1326) AUTHORS Suzuki HR, Padanilam BJ, Vitale E, Ramirez F and Solursh M. TITLE Repeating developmental expression of G-Hox 7, a novel homeobox-containing gene in the chicken JOURNAL Dev Biol 148 (1), 375-388 (1991) PUBMED 1682191 REMARK Erratum:[Dev Biol. 1992 Apr;150(2):427. PMID: 1348039] COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000074.1. On Sep 23, 2021 this sequence version replaced NM_205488.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: D10372.1, SRR13267654.237058.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992290, SAMEA103992393 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 JAENSK010000074.1 31366248-31366775 529-1326 JAENSK010000074.1 31367955-31368752 FEATURES Location/Qualifiers source 1..1326 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="4" /map="4" gene 1..1326 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="msh homeobox 1" /db_xref="CGNC:11159" /db_xref="GeneID:396484" exon 1..528 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /inference="alignment:Splign:2.1.0" CDS 93..959 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="homeobox protein GHOX-7; Hbox 7; homeobox protein Hox-7; msh homeobox 1-like protein; msh homeobox homolog 1; msh homeo box homolog 1" /codon_start=1 /product="homeobox protein MSX-1" /protein_id="NP_990819.1" /db_xref="CGNC:11159" /db_xref="GeneID:396484" /translation="
MAPAADMTTAPTGVRSDEPPASAFSKPGGGLPVAAAMGGEEESDKPKVSPSPLPFSVEALMADRRKPPGGRDGPEGSGPPLGSARANLGALTTEAPTSPLPLGGHFPSVGALGKLPEDALLKAESPEKPERSPWMQSPRFSPPPPRRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGISFPLGGPAVAGASLYGASSPFQRAGLPVAPVGLYTAHVGYSMYHLT"
misc_feature 93..425 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="propagated from UniProtKB/Swiss-Prot (P50223.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 459..548 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="propagated from UniProtKB/Swiss-Prot (P50223.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(576..590,594..596,645..647,663..665,702..704, 708..713,720..725,729..737,741..746) /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 582..743 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(582..584,591..593,711..713,720..725,732..734) /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 529..1326 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /inference="alignment:Splign:2.1.0" ORIGIN
ggaccgcgccgacggctcccgcgcctccgccgcgccctcatgagccgcggccgccgctcccgcggagcacggcgacagcggggccgccctgcatggccccggctgcggacatgaccaccgcgcccaccggcgtccgcagcgacgagccgcccgcctccgccttcagcaagcccggcggcggcctccccgtcgcggcggcgatgggcggcgaggaggagagcgacaaacccaaggtgtccccttccccgctgcccttcagcgtggaagcgctcatggccgaccgcaggaagccgccgggcggcagagacggtcccgagggttccgggccccctctgggctccgcccgagccaacctcggcgctctgacgacggaggcaccgacgtcgccgctgcctctcggcggccacttcccgtccgtcggggcgctgggcaagctgcccgaggacgcgctgctcaaagcagagagccccgagaagccggagcggagcccctggatgcagagcccccgcttctcgccgcccccgcccaggcggctgagcccccccgcctgcaccctgcgcaagcacaagaccaacaggaagccccggacgcccttcaccacggcccagctgctggccctggagaggaaattccgccagaagcagtacctgtccatcgccgagcgcgccgagttctccagctcgctcagcctcaccgagacgcaggtgaagatctggttccagaaccgccgtgccaaggccaagcggctgcaggaggccgagctggagaagctgaagatggcagccaagcccatgctcccgcctgctgcattcggcatctccttcccgttgggcggcccagcagtggccggcgcatccctgtacggagcctccagccccttccagcgagcggggctgcccgtggcccctgtgggactgtacacggcgcacgtgggatatagtatgtaccaccttacatagggccgagccgcccgtgcgggcccccggcagagacttctccgctcccttcatccagaccttcaaccctgggatctgttctgtgcctggcaggaaggaacccgtggtgcggccttgctggcacctggggaaggaactgtggcagagaaagggcacaaaggcagcccagtaggacatttctgcaaggcgagggtgggaggcagagccgcctgtcccgtccctgcagggcagctgttaacctgtggccattcctccgccagctcctgaggaaggggctctctctgtgtactatgtaatatactgtatatttgaaattttattatcatttatattatagctatatttgttaaataaattaattttaagctac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]