2024-05-18 14:07:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_204311 1468 bp mRNA linear VRT 24-SEP-2023 DEFINITION Gallus gallus caudal type homeobox 2 (CDX2), mRNA. ACCESSION NM_204311 VERSION NM_204311.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 1468) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 1468) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1468) AUTHORS Pernaute B, Canon S, Crespo M, Fernandez-Tresguerres B, Rayon T and Manzanares M. TITLE Comparison of extraembryonic expression of Eomes and Cdx2 in pregastrulation chick and mouse embryo unveils regulatory changes along evolution JOURNAL Dev Dyn 239 (2), 620-629 (2010) PUBMED 20014105 REMARK GeneRIF: expressed in extraembryonic tissues, but temporal pattern of expression differs from what occurs in mouse REFERENCE 4 (bases 1 to 1468) AUTHORS Marom K, Shapira E and Fainsod A. TITLE The chicken caudal genes establish an anterior-posterior gradient by partially overlapping temporal and spatial patterns of expression JOURNAL Mech Dev 64 (1-2), 41-52 (1997) PUBMED 9232595 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAENSK010000027.1. On Nov 9, 2021 this sequence version replaced NM_204311.1. ##Evidence-Data-START## Transcript exon combination :: U80614.1, SRR12888491.331455.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA103992323, SAMEA103992484 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-767 JAENSK010000027.1 23068699-23069465 768-913 JAENSK010000027.1 23071240-23071385 914-1468 JAENSK010000027.1 23071617-23072171 FEATURES Location/Qualifiers source 1..1468 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="1" /map="1" gene 1..1468 /gene="CDX2" /note="caudal type homeobox 2" /db_xref="CGNC:12839" /db_xref="GeneID:374205" exon 1..767 /gene="CDX2" /inference="alignment:Splign:2.1.0" misc_feature 50..52 /gene="CDX2" /note="upstream in-frame stop codon" CDS 251..1084 /gene="CDX2" /note="caudal type homeo box transcription factor 2; caudal type homeobox transcription factor 2" /codon_start=1 /product="homeobox protein CDX-2" /protein_id="NP_989642.2" /db_xref="CGNC:12839" /db_xref="GeneID:374205" /translation="
MYVSYLLDKDGPMYPGPVRHSGGLNLAAQNFVGAAQYADYGGYHVNLDGAQSPGPAWPAPYAAPLRDDWGAYGQGAPPPAAAAAVHGLNGGSPAAAMAYSPADFHHHHHHHPHAHHHAGPAPHCSAGGMQPLGAAPAAAAASAAPEPLSPGGQRRGLCEWVRKPAQAPLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELASSLGLSERQVKIWFQNRRAKERKINKKKLQQAQPGAAEPLSPTAPPLPGPAAAPPPAGLGPAAPQ"
misc_feature 287..751 /gene="CDX2" /note="Caudal like protein activation region; Region: Caudal_act; pfam04731" /db_xref="CDD:428094" misc_feature order(788..799,803..805,854..856,872..874,911..913, 917..922,929..934,938..946,950..955) /gene="CDX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(791..793,800..802,920..922,929..934,941..943) /gene="CDX2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 794..952 /gene="CDX2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 768..913 /gene="CDX2" /inference="alignment:Splign:2.1.0" exon 914..1468 /gene="CDX2" /inference="alignment:Splign:2.1.0" ORIGIN
gcctttggtgtgtctgggccattactaatagagccttgtaaacaatcgttaatcatgtaagcgctgccggccatcgccttcggaccgggagcgctcggcggcggcgaactgcgcggggccgcggcccctccgcctgccccctccccgccgcgggagcccggccccgggcggcggcgctccgacggccccggcagcggcgctccgacggccccagcagcatgccgagagcggccgccggggccccgccagcatgtacgtgagctacctcctggacaaggacgggcccatgtaccccggccccgttcgccactcgggggggctcaacctggcggcgcagaacttcgtgggcgccgcgcaatacgcggactacggcggctaccatgtgaacctcgacggcgcgcagtcccccgggccggcctggcccgcgccctacgccgctcctctccgcgacgactggggggcctacgggcagggagcccctccgcccgccgccgccgccgccgtgcacggcctcaacggcggctcccccgccgcagcgatggcctacagccccgccgacttccaccaccaccaccaccaccacccgcacgcccaccaccacgccggccccgcgccgcactgctccgccggggggatgcagcctctcggcgccgcccccgccgccgccgccgcctccgccgcccccgagccgctgtcccccggcgggcagcgccgcggcctctgcgagtgggtgaggaaaccggcgcaggccccgctcggtagccaagtcaaaaccaggacgaaggacaaataccgcgtggtgtacacggaccaccagcggttggagctggagaaggagttccactacagccgctatatcaccatccggaggaaagctgagctggcctccagcctggggctgtcggagaggcaggtgaaaatctggttccagaaccgtcgggcgaaggagaggaagatcaacaagaagaagctgcagcaggcgcagcccggcgccgcggagccgctcagccccaccgcccctccgcttcccggccccgcggccgcaccgccacccgccgggctgggccccgccgccccgcagtgacagcggccccggccgagcgcagggactgcacggaccgcggagggacggccgggccgggccggggccggaggggccccgcggccacagcgggagcggccccaatgcactgcagcgccgtgtgtacagatgtacagtgagcgcgtctcgtccggggaaccgcggcttcggtgttattaatgttattatggttttctttcgtcggtatttttccttttattttttatttttattttttttaccctggcctttgttaggtgtaaggggagcgtggcactccccagtgaatctcagggatcggcgcgaaggtctgagcgatgctgttgggctgacgatgaattttattgggaaagaaagaaagaaaaaattaaagcacattggtttttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]