GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 17:22:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_204193               1150 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus BARX homeobox 1 (BARX1), mRNA.
ACCESSION   NM_204193
VERSION     NM_204193.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1150)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1150)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1150)
  AUTHORS   Nakamura M, Nishida W, Mori S, Hiwada K, Hayashi K and Sobue K.
  TITLE     Transcriptional activation of beta-tropomyosin mediated by serum
            response factor and a novel Barx homologue, Barx1b, in smooth
            muscle cells
  JOURNAL   J Biol Chem 276 (21), 18313-18320 (2001)
   PUBMED   11359793
REFERENCE   4  (bases 1 to 1150)
  AUTHORS   Barlow AJ, Bogardi JP, Ladher R and Francis-West PH.
  TITLE     Expression of chick Barx-1 and its differential regulation by FGF-8
            and BMP signaling in the maxillary primordia
  JOURNAL   Dev Dyn 214 (4), 291-302 (1999)
   PUBMED   10213385
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAENSK010000252.1.
            
            On Sep 23, 2021 this sequence version replaced NM_204193.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB044371.1, AF116460.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992432, SAMEA103992440
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-257               JAENSK010000252.1  3284076-3284332
            258-546             JAENSK010000252.1  3285349-3285637
            547-631             JAENSK010000252.1  3285729-3285813
            632-1150            JAENSK010000252.1  3286039-3286557
FEATURES             Location/Qualifiers
     source          1..1150
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="12"
                     /map="12"
     gene            1..1150
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /note="BARX homeobox 1"
                     /db_xref="CGNC:3820"
                     /db_xref="GeneID:374017"
     exon            1..257
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /inference="alignment:Splign:2.1.0"
     CDS             53..796
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /note="homeobox protein BarH-like 1b; BarH-like homeobox
                     1; bar class homeoprotein Barx1b; homeodomain-containing
                     transcription factor BarX-1"
                     /codon_start=1
                     /product="homeobox protein BarH-like 1"
                     /protein_id="NP_989524.2"
                     /db_xref="CGNC:3820"
                     /db_xref="GeneID:374017"
                     /translation="
MQHPLELGAAHYFPAEAFPDHRSHRYRSFMIEEILTDPPDAKGAAPPGELLKFGVQALLSARPYHSHLAVLKAEPAAVFKFPLAPLGCSGLGSALLAAGSGLQGGSASPHLPLELHLRGKLEPGGPETGSKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPSSEQLSEQERARDAEKPPESLGSPAEVSQEE"
     misc_feature    404..466
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9DED6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(458..472,476..478,527..529,545..547,584..586,
                     590..595,602..607,611..619,623..628)
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    464..625
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(464..466,473..475,593..595,602..607,614..616)
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    641..793
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9DED6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            258..546
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /inference="alignment:Splign:2.1.0"
     exon            547..631
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /inference="alignment:Splign:2.1.0"
     exon            632..1150
                     /gene="BARX1"
                     /gene_synonym="BARX1B"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agggcccggcggccgggctcggctcggcacggcccgggcggcggcggcgaggatgcagcacccgctggagctgggggccgcgcactacttcccggccgaagcctttcccgaccaccgctcgcaccgctaccgcagtttcatgattgaggagatcctcaccgacccccccgacgccaaaggcgcggcgccgcccggggagctgctcaagttcggggtgcaggcgctgctgtcggcccggccctaccacagccacctcgccgttctgaaggcggagccggcggccgtcttcaagttcccgctggctcccctgggctgctcggggctgggctcggcgctgctggccgccggctcggggctgcagggcggctccgcctcgccccacctcccgctggagctgcacctccgcggcaagctggagccgggcggccccgagacgggcagcaaggccaagaagggccgccgcagccgcaccgtcttcacggagctgcagctcatggggctggagaagcgcttcgagaagcagaagtacctctcgacgcccgacagaatagacctggccgaatcgctggggctcagccagctccaggtgaaaacctggtaccagaacaggcgcatgaaatggaagaaaatagtgctgcaggggggcggcctggagtcccccaccaagcccaagggccgccccaagaagaactccatccccagcagcgagcagctctcggagcaggagcgcgcccgggacgccgagaaaccccccgagagcctgggctcgccggctgaggtcagccaggaggagtgagggcacggcccggccccaccgctgccgcccgggagcgcggggacccccagcgccgcgccgggccccggagcgcgttgccccgggcgggaggaaccccgcgcgcagcggcccgggcggtagaggacgggggcggagggcggtggggccgcggtcggagcactcggcgcacagctcggcccccggccctgagacccgcggtgcgcggcggccggggggcaccgggtccgccctcggcattgctcgctgcgtgaaaccctgtggtgcccccagttactcgaaaaactgcattttacgatcggttttattaatgcgaagatatttactttatttcaataaagtattttatggactatt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]