2024-05-19 00:48:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_061956917 243 bp mRNA linear VRT 26-DEC-2023 DEFINITION PREDICTED: Nerophis lumbriciformis small VCP interacting protein (svip), mRNA. ACCESSION XM_061956917 VERSION XM_061956917.1 DBLINK BioProject: PRJNA1054156 KEYWORDS RefSeq; includes ab initio. SOURCE Nerophis lumbriciformis (worm pipefish) ORGANISM Nerophis lumbriciformis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Syngnathiaria; Syngnathiformes; Syngnathoidei; Syngnathidae; Nerophis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026906091) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_033978685.1-RS_2023_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/19/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 6% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..243 /organism="Nerophis lumbriciformis" /mol_type="mRNA" /strain="RoL_2023-P1" /db_xref="taxon:546530" /chromosome="Unknown" /sex="male" /tissue_type="Whole Body Except internal Organs" /dev_stage="adult" /country="Portugal" /collection_date="2021-06-15" gene 1..243 /gene="svip" /note="small VCP interacting protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:133603655" CDS 1..243 /gene="svip" /codon_start=1 /product="small VCP/p97-interacting protein" /protein_id="XP_061812901.1" /db_xref="GeneID:133603655" /translation="
MGMCLPCFGGAVDDAVDTPDPETRRRQLAEAAEKRQKETAHRGVKNPEAVERKRKKQEEIEKQTMSTSVSSGGGLRWQVG"
ORIGIN
atggggatgtgcctaccgtgctttggtggggcagtcgacgacgctgttgacactccagatccagagacgaggaggcgacagttagccgaggctgcagaaaaaagacaaaaagagacagcacacaggggtgttaaaaacccagaagcggttgaaaggaaaagaaaaaagcaagaagagattgaaaaacagacgatgagtacatctgtgtctagtggtggcgggttgaggtggcaggtgggctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]