2024-05-18 19:48:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_057283325 294 bp mRNA linear PLN 12-JUN-2023 DEFINITION Penicillium samsonianum RNA interference and gene silencing protein (N7471_010606), partial mRNA. ACCESSION XM_057283325 VERSION XM_057283325.1 DBLINK BioProject: PRJNA973687 BioSample: SAMN30185370 KEYWORDS RefSeq. SOURCE Penicillium samsonianum ORGANISM Penicillium samsonianum Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium. REFERENCE 1 (bases 1 to 294) AUTHORS Petersen,C., Sorensen,T., Nielsen,M.R., Sondergaard,T.E., Sorensen,J.L., Fitzpatrick,D.A., Frisvad,J.C. and Nielsen,K.L. TITLE Comparative genomic study of the Penicillium genus elucidates a diverse pangenome and 15 lateral gene transfer events JOURNAL IMA Fungus 14 (1), 3 (2023) PUBMED 36726175 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 294) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (09-JUN-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 294) AUTHORS Petersen,C. TITLE Direct Submission JOURNAL Submitted (14-JAN-2023) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_026643264). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..294 /organism="Penicillium samsonianum" /mol_type="mRNA" /strain="IBT 33392" /culture_collection="IBT:33392" /type_material="culture from holotype of Penicillium samsonianum" /db_xref="taxon:1882272" /chromosome="Unknown" gene <1..>294 /locus_tag="N7471_010606" /db_xref="GeneID:81935107" CDS 1..294 /locus_tag="N7471_010606" /note="Argonaute linker 1 domain" /codon_start=1 /product="RNA interference and gene silencing protein" /protein_id="XP_057132304.1" /db_xref="GeneID:81935107" /translation="
MREYMEYLTNSGLGGNKHCSLDASTGEKAALGGGLEALRGFFVSVRAATAQVLLNVQVKYLARYQEGPLPMVIGDYQRANPRSLYPLKSFFEAHACP"
misc_feature <94..195 /locus_tag="N7471_010606" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:430160" ORIGIN
atgagagaatacatggagtatttaacaaattcaggtcttggtggtaacaagcattgcagcctggatgcctccacaggcgaaaaagccgctttgggcggcggtttggaagctctgcgtggtttcttcgtcagtgtccgtgcggccactgctcaggtgctattgaatgtccaagtcaagtatctggcccgctaccaagagggtcctctgccgatggtgattggagattaccagcgcgcaaatccgcgcagcctttacccgctaaagtctttttttgaggcacatgcgtgtccgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]