2024-06-15 09:59:43, GGRNA.v2 : RefSeq release 224 (May, 2024)
LOCUS XM_043328844 567 bp mRNA linear PLN 27-AUG-2021 DEFINITION Rhizoctonia solani Lytic polysaccharide mono-oxygenase, cellulose-degrading (RhiXN_09028), partial mRNA. ACCESSION XM_043328844 VERSION XM_043328844.1 DBLINK BioProject: PRJNA727464 BioSample: SAMN14572378 KEYWORDS RefSeq. SOURCE Rhizoctonia solani ORGANISM Rhizoctonia solani Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia. REFERENCE 1 (bases 1 to 567) AUTHORS Li,C. and Chen,X. TITLE Evolutionary and genomic comparisons of hybrid uninucleate and nonhybrid Rhizoctonia fungi JOURNAL Unpublished REFERENCE 2 (bases 1 to 567) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (27-AUG-2021) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 567) AUTHORS Li,C. and Chen,X. TITLE Direct Submission JOURNAL Submitted (18-MAY-2020) Department of Plant Pathology, China Agricultural University, Yuanmingyuan Xilu 2, Beijing 100193, China COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_057374). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..567 /organism="Rhizoctonia solani" /mol_type="mRNA" /strain="AG-1 IA" /isolate="XN" /isolation_source="maize" /db_xref="taxon:456999" /chromosome="5" /collection_date="2014" /collected_by="CAU" gene <1..>567 /locus_tag="RhiXN_09028" /db_xref="GeneID:67031307" CDS 1..567 /locus_tag="RhiXN_09028" /codon_start=1 /product="Lytic polysaccharide mono-oxygenase, cellulose-degrading" /protein_id="XP_043180290.1" /db_xref="GeneID:67031307" /translation="
MRFLAGLLTLATLASSVVAHGIVTQPPTRTLGSAMIAACGEGAVSAQKSNVKGPIESQIAKIDSNYKPAQCNLFLCRGQQFADNKDKVQTYKTGQVVNIVLDIENHHPVGYANVSVIDTATNKMVGKPLIAWDPYFTGYPYPKDQENFNVTIPELSGKCKTAGECVLQYHWYSRTDRQTYQNCVDFVV"
misc_feature 58..558 /locus_tag="RhiXN_09028" /note="Lytic polysaccharide mono-oxygenase, cellulose-degrading; Region: LPMO_10; pfam03067" /db_xref="CDD:460793" ORIGIN
atgcgcttcctggctggtttattgactttggcgactttggcgtcgtccgttgtcgctcatggcattgtaactcaacctccaactcgcacactcgggagtgccatgattgcagcttgcggtgaaggtgctgtctcggctcaaaaatccaatgtcaagggaccgattgaaagccagattgccaagattgattccaactacaagcccgcgcaatgcaatctcttcttgtgccgtggccaacagtttgctgacaacaaggacaaagtccaaacctacaagactggtcaagtcgtgaacattgtactagacattgagaaccaccatcctgttggctatgcaaacgtatctgttatcgatactgccacaaacaagatggttggcaagcctctgattgcatgggatccttactttactggttatccgtaccctaaggatcaagagaacttcaacgtcactattccagagctcagcggcaaatgcaagactgccggagaatgtgttctacaataccactggtactcccgaacggacaggcagacttaccaaaactgcgtagatttcgttgtttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]