2024-05-17 13:42:16, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_011412523 273 bp mRNA linear PLN 29-DEC-2023 DEFINITION Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory protein (MAA_11608), partial mRNA. ACCESSION XM_011412523 VERSION XM_011412523.1 DBLINK BioProject: PRJNA245140 BioSample: SAMN02981260 KEYWORDS RefSeq. SOURCE Metarhizium robertsii ARSEF 23 ORGANISM Metarhizium robertsii ARSEF 23 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Clavicipitaceae; Metarhizium. REFERENCE 1 (bases 1 to 273) AUTHORS Hu,X., Xiao,G., Zheng,P., Shang,Y., Su,Y., Zhang,X., Liu,X., Zhan,S., St Leger,R.J. and Wang,C. TITLE Trajectory and genomic determinants of fungal-pathogen speciation and host adaptation JOURNAL Proc. Natl. Acad. Sci. U.S.A. 111 (47), 16796-16801 (2014) PUBMED 25368161 REFERENCE 2 (bases 1 to 273) AUTHORS Gao,Q., Jin,K., Ying,S.H., Zhang,Y., Xiao,G., Shang,Y., Duan,Z., Hu,X., Xie,X.Q., Zhou,G., Peng,G., Luo,Z., Huang,W., Wang,B., Fang,W., Wang,S., Zhong,Y., Ma,L.J., St Leger,R.J., Zhao,G.P., Pei,Y., Feng,M.G., Xia,Y. and Wang,C. TITLE Genome sequencing and comparative transcriptomics of the model entomopathogenic fungi Metarhizium anisopliae and M. acridum JOURNAL PLoS Genet. 7 (1), E1001264 (2011) PUBMED 21253567 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 273) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 4 (bases 1 to 273) AUTHORS Hu,X., Xiao,G., Shang,Y., Chen,P., Huang,W., Chen,Y., Xu,Y.-J. and Wang,C. TITLE Direct Submission JOURNAL Submitted (07-DEC-2013) Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fengling Road, Shanghai, Shanghai 200032, China REFERENCE 5 (bases 1 to 273) AUTHORS Gao,Q., Jin,K., Ying,S., Luo,Z., Xiao,G., Duan,Z., Xie,X., Zhou,G., Peng,G., Zhang,Y., Shang,Y.F., Huang,W., Wang,B., Wang,S., Fang,W., Ma,L.-J., Liu,X., St. Leger,R.J., Pei,Y., Feng,M., Xia,Y. and Wang,C. CONSRTM Metarhizium genome sequencing Consortium TITLE Direct Submission JOURNAL Submitted (10-MAY-2010) Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fenglin Road, Shanghai, Shanghai 200032, China COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_011942151). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..273 /organism="Metarhizium robertsii ARSEF 23" /mol_type="mRNA" /strain="ARSEF 23" /host="Conoderus sp." /db_xref="taxon:655844" /chromosome="Unknown" /country="USA: North Carolina" /collection_date="1961" gene <1..>273 /locus_tag="MAA_11608" /db_xref="GeneID:23633056" CDS 1..273 /locus_tag="MAA_11608" /codon_start=1 /product="Fungal transcriptional regulatory protein" /protein_id="XP_011410825.1" /db_xref="GeneID:23633056" /translation="
MIALKSWKKSERVRWDGNKHSPEETAGLFGLGALSWLNPLSLAGYKKRLALEDLYRLDCNLASEHLQVNHPPVSTVCAVALGNVTVWPER"
misc_feature 46..>174 /locus_tag="MAA_11608" /note="ABC transporter C family member; Provisional; Region: PLN03130" /db_xref="CDD:215595" ORIGIN
atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]