2024-05-17 14:46:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_003229462 1742 bp mRNA linear VRT 31-MAY-2016 DEFINITION PREDICTED: Anolis carolinensis VCP interacting membrane selenoprotein (vimp), mRNA. ACCESSION XM_003229462 VERSION XM_003229462.3 DBLINK BioProject: PRJNA60547 KEYWORDS RefSeq. SOURCE Anolis carolinensis (green anole) ORGANISM Anolis carolinensis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata; Toxicofera; Iguania; Dactyloidae; Anolis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_003339489.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On May 31, 2016 this sequence version replaced XM_003229462.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Anolis carolinensis Annotation Release 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1742 /organism="Anolis carolinensis" /mol_type="mRNA" /db_xref="taxon:28377" /chromosome="Unknown" /country="USA" gene 1..1742 /gene="vimp" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 ESTs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 22 samples with support for all annotated introns" /db_xref="GeneID:100551705" CDS 63..611 /gene="vimp" /codon_start=1 /product="selenoprotein S" /protein_id="XP_003229510.1" /db_xref="GeneID:100551705" /translation="
MAADLRPGTPTEQEGAQVLQQTVVSLLSDYGWFILFSLIAVYLLVQKLSKTFRSTSKHSLDTTDIEPEAVVRQQEALLAARLRMQEELNAQAEKFKEKQKKLEEEKRKQKIAMWESMQEGKSYKENLRQNQEPQSGASTSTSVPKPKPRSKPLREGGYNPLSGDGGGTCSWRPGRRGPSSGG"
misc_feature 90..608 /gene="vimp" /note="Selenoprotein S (SelS); Region: Selenoprotein_S; pfam06936" /db_xref="CDD:429198" ORIGIN
tgacgtcccgctttctcattcgtgactcggcagcgggaggacccggatgtaggtgctgcaagatggcggcggatctgaggcctggtacgccgacggagcaggaaggcgctcaagtccttcagcaaaccgtggtttcattgctctcagactatggctggttcatcctcttcagtcttattgctgtttatttacttgtacaaaagctttccaaaacatttcgaagcaccagcaagcactccttggacacaacagatattgaacctgaggctgtggttagacaacaggaggctttgcttgctgcccgtctgagaatgcaagaagaactgaatgcacaagcagaaaaattcaaagaaaaacagaaaaagcttgaagaggagaaacgaaaacaaaagatcgccatgtgggaaagtatgcaggaaggcaaaagttacaaggagaatctcagacagaaccaggaacctcagtctggagcctcaacatcaaccagtgtcccaaagccaaaaccgagaagcaaacctttacgagaggggggttacaaccctctgtctggagacggtggcgggacctgctcatggagacccgggcgcagaggtccttcatcgggtggatgaggctagcttctgccagtgtcttctttgaacactggcagacactaatctggccccatagctgcagctgtctgtgggttgcttgacacagggacttagtggagggtagattagtactttagtgactcagagatatatgaaagaaaaaatgtaaatacagctgggagtgccatggaagcagcaggaagaaaatggtagaagcagaaagggaatgtcatgaggatgacttttctttttgagagcaaagcattgccatccatgcgttcccccaggttcttgtgtgcaatgggaacatccattgcataagagtttaggaccaaactccctgccaaagtgccttgggctctgcaggggacaaaacctgtttgaaatggcatgtttccctgctccaatttttgggggagtaagttttagatgccaaagctgggttttcctcacaatatccagcaaaggcagagcaagacaactggtagttgatccaatgtcactatttaaggccctgagaataagaagcattggaaatggtgctactttggatgttgagaccccaggtgtctcctgccaacagcttccaaactggctgagccacacactcatctggttggtaaatgtagccagttctcctttgaggtcatatcaaaagaatatttgagtttggttttggggttcaactcttcacaaagatggagcaatagatgcagcacattgagaaactccctgtaacaagcagcaacaaatgacgtggtccttataaatggtggacacatcactgaggacctccgaagataagacagctgattggggacagttcttgccctgccctcctcctgtttcatctgctttgtaagacaaaatactgtaaataacattagcagccttctttctttcggtggctcttttctatacaggaaagtacgtactcttgcttaatgaccatgtctcaagactgccatcctgtacacaggtaccgtggagtaagccatattggactgtgtgtgcttgcttctaggtaaacgtgtctgtgactgtgggtaaaacaggttgcatcattggtgtgtggcttgttccggacaaaaggcctcctcatactccatttcaaactgttgcttaataaattctatttctttagcatca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]