2024-05-17 14:05:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001277768 843 bp mRNA linear VRT 19-SEP-2023 DEFINITION Gallus gallus claudin 10 (CLDN10), transcript variant 2, mRNA. ACCESSION NM_001277768 VERSION NM_001277768.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. REFERENCE 1 (bases 1 to 843) AUTHORS Tang H, Finn RD and Thomas PD. TITLE TreeGrafter: phylogenetic tree-based annotation of proteins with Gene Ontology terms and other annotations JOURNAL Bioinformatics 35 (3), 518-520 (2019) PUBMED 30032202 REFERENCE 2 (bases 1 to 843) AUTHORS Collins MM, Baumholtz AI, Simard A, Gregory M, Cyr DG and Ryan AK. TITLE Claudin-10 is required for relay of left-right patterning cues from Hensen's node to the lateral plate mesoderm JOURNAL Dev Biol 401 (2), 236-248 (2015) PUBMED 25744724 REMARK GeneRIF: The data demonstrate a novel role for Claudin-10 during the transmission of laterality information from Hensen's node to both the left and right sides of the embryo. [claudin-10] REFERENCE 3 (bases 1 to 843) AUTHORS Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C, Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S. TITLE Manual GO annotation of predictive protein signatures: the InterPro approach to GO curation JOURNAL Database (Oxford) 2012, bar068 (2012) PUBMED 22301074 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 843) AUTHORS Seo HW, Rengaraj D, Choi JW, Ahn SE, Song YS, Song G and Han JY. TITLE Claudin 10 is a glandular epithelial marker in the chicken model as human epithelial ovarian cancer JOURNAL Int J Gynecol Cancer 20 (9), 1465-1473 (2010) PUBMED 21370593 REMARK GeneRIF: New insight into using the chicken as a suitable animal model for investigating the effect and function of CLDN in human ovarian cancer. REFERENCE 5 (bases 1 to 843) AUTHORS Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R, Burnside J, Aggrey SE, Simon J and Cogburn LA. TITLE Chicken genomics resource: sequencing and annotation of 35,407 ESTs from single and multiple tissue cDNA libraries and CAP3 assembly of a chicken gene index JOURNAL Physiol Genomics 25 (3), 514-524 (2006) PUBMED 16554550 REFERENCE 6 (bases 1 to 843) AUTHORS Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ. TITLE A comprehensive collection of chicken cDNAs JOURNAL Curr Biol 12 (22), 1965-1969 (2002) PUBMED 12445392 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BU380770.1, BU121320.1, BX930125.1 and JAENSK010000025.1. Transcript Variant: This variant (2) uses an alternate in-frame splice junction at the 5' end of an internal exon compared to variant 1. The resulting isoform (2) has the same N- and C-termini but is shorter compared to isoform 1. ##Evidence-Data-START## RNAseq introns :: partial sample support SAMEA103992290, SAMEA103992323 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-230 BU380770.1 1-230 231-342 BU121320.1 242-353 343-835 BX930125.1 457-949 836-843 JAENSK010000025.1 18150826-18150833 c FEATURES Location/Qualifiers source 1..843 /organism="Gallus gallus" /mol_type="mRNA" /db_xref="taxon:9031" /chromosome="1" /map="1" /breed="Leghorn" gene 1..843 /gene="CLDN10" /gene_synonym="claudin-10" /note="claudin 10" /db_xref="CGNC:13756" /db_xref="GeneID:418790" exon 1..230 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" CDS 11..577 /gene="CLDN10" /gene_synonym="claudin-10" /note="isoform 2 precursor is encoded by transcript variant 2" /codon_start=1 /product="claudin-10 isoform 2 precursor" /protein_id="NP_001264697.1" /db_xref="CGNC:13756" /db_xref="GeneID:418790" /translation="
MASTSAEIVAFLLTISGWVLVSSTLPTDYWKVSSIDGTVITTATFWANLWKTCVTDSTGVSNCKDFPSMLALDARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV"
sig_peptide 11..79 /gene="CLDN10" /gene_synonym="claudin-10" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 29..427 /gene="CLDN10" /gene_synonym="claudin-10" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" exon 231..272 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" exon 273..354 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" exon 355..462 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" exon 463..843 /gene="CLDN10" /gene_synonym="claudin-10" /inference="alignment:Splign:2.1.0" ORIGIN
gtcgggcccgatggcgagcacgtcggcggagatcgtcgccttcctgctgaccatctccggctgggtgctggtgtcgtccacgctgcccaccgactactggaaggtgtcttccatcgacggcacggtcatcaccaccgccaccttctgggccaacctctggaagacctgcgtgaccgactccaccggcgtctccaactgcaaggacttcccgtccatgctggctctcgacgcaagaatagcttgtttagctggactgattttcatactgtgtgggctgtgctccatgactggttgttccctgtatgcacacaggattacgtctgagttctttgatccttcttttgttgcacaaaagtatgaattaggagcagctttattcattggatgggctggagcttcactctgcatcattggtggcagtatattctgcttctcaatagctgagaacagtaaatctccaaggagagcgtatgcatataatggagccgcatctgtgatgtcgtctcgtacaaagattcacaacagtgtcccagacaaaacctcaccaaagcactttgacaagaacgcttacgtttaagtgtacttttctaagatctgaagccagttttaaaaatgagtttgtatgtttcattcagggtgatttccccccccacctccccacaacacaatggaattaccactaagaatgaatttgtaaggtgttatcttgcagctttttccacgttgatgtaaattttattatattttaagattgatgtttgtattataaagtttatacctgcaaatcatgcattgatgctgctttctaaaaaagaaaaataaagagggtatttacagatgcag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]