GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 08:41:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_179935                876 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana homeobox protein 22 (HB22), mRNA.
ACCESSION   NM_179935
VERSION     NM_179935.2
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 876)
  AUTHORS   Lin,X., Kaul,S., Rounsley,S., Shea,T.P., Benito,M.I., Town,C.D.,
            Fujii,C.Y., Mason,T., Bowman,C.L., Barnstead,M., Feldblyum,T.V.,
            Buell,C.R., Ketchum,K.A., Lee,J., Ronning,C.M., Koo,H.L.,
            Moffat,K.S., Cronin,L.A., Shen,M., Pai,G., Van Aken,S., Umayam,L.,
            Tallon,L.J., Gill,J.E., Adams,M.D., Carrera,A.J., Creasy,T.H.,
            Goodman,H.M., Somerville,C.R., Copenhaver,G.P., Preuss,D.,
            Nierman,W.C., White,O., Eisen,J.A., Salzberg,S.L., Fraser,C.M. and
            Venter,J.C.
  TITLE     Sequence and analysis of chromosome 2 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 761-768 (1999)
   PUBMED   10617197
REFERENCE   2  (bases 1 to 876)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 876)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 876)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003071).
            
            On Sep 12, 2016 this sequence version replaced NM_179935.1.
FEATURES             Location/Qualifiers
     source          1..876
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="2"
                     /ecotype="Columbia"
     gene            1..876
                     /gene="HB22"
                     /locus_tag="AT2G36610"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22;
                     ATHB22; F13K3.1; F13K3_1; homeobox protein 22"
                     /note="Encodes a homeodomain leucine zipper class I
                     (HD-Zip I) protein."
                     /db_xref="Araport:AT2G36610"
                     /db_xref="GeneID:818233"
                     /db_xref="TAIR:AT2G36610"
     CDS             117..674
                     /gene="HB22"
                     /locus_tag="AT2G36610"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22;
                     ATHB22; F13K3.1; F13K3_1; homeobox protein 22"
                     /inference="Similar to RNA sequence,
                     EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1"
                     /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1"
                     /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA
                     binding, sequence-specific DNA binding transcription
                     factor activity; INVOLVED IN: regulation of transcription,
                     DNA-dependent, regulation of transcription; LOCATED IN:
                     nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling
                     growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved
                     site (InterPro:IPR017970), Homeobox (InterPro:IPR001356),
                     Homeodomain-like (InterPro:IPR009057), Helix-turn-helix
                     motif, lambda-like repressor (InterPro:IPR000047),
                     Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis
                     thaliana protein match is: homeobox 51 (TAIR:AT5G03790.1);
                     Has 3535 Blast hits to 3534 proteins in 270 species:
                     Archae - 0; Bacteria - 0; Metazoa - 1530; Fungi - 95;
                     Plants - 1868; Viruses - 3; Other Eukaryotes - 39 (source:
                     NCBI BLink)."
                     /codon_start=1
                     /product="homeobox protein 22"
                     /protein_id="NP_850266.1"
                     /db_xref="Araport:AT2G36610"
                     /db_xref="GeneID:818233"
                     /db_xref="TAIR:AT2G36610"
                     /translation="
MEYWSSSFIDGASSSSFISPFYNFDHFSGNQDNRCLGTMMGAQQDILHVPLAMVESGYGEESNSFNGQEKKKKKMTSEQLKFLERSFQEEIKLNPDRKMKLNPDRKMKLSKELGLQPRQIAVWFQNRKARWKNKQLEHLYESLRQEFDIVSREKELLQEELIQLKSMIREDSSCKKKQTWEKACS"
     misc_feature    order(324..335,339..341,414..416,432..434,471..473,
                     477..482,489..494,498..506,510..515)
                     /gene="HB22"
                     /locus_tag="AT2G36610"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22;
                     ATHB22; F13K3.1; F13K3_1; homeobox protein 22"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(327..329,336..338,480..482,489..494,501..503)
                     /gene="HB22"
                     /locus_tag="AT2G36610"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22;
                     ATHB22; F13K3.1; F13K3_1; homeobox protein 22"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    342..512
                     /gene="HB22"
                     /locus_tag="AT2G36610"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22;
                     ATHB22; F13K3.1; F13K3_1; homeobox protein 22"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    516..617
                     /gene="HB22"
                     /locus_tag="AT2G36610"
                     /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22;
                     ATHB22; F13K3.1; F13K3_1; homeobox protein 22"
                     /note="Homeobox associated leucine zipper; Region: HALZ;
                     cl23880"
                     /db_xref="CDD:451592"
ORIGIN      
cccatatcaaacacccaaagttgctcatttccttgtttaggtaaaaaatagtctcttgaaagtgattgttgtaagcagagatagacaaaagaggtaaaaaaaaagaagaagagaagatggaatattggagcagctccttcatcgatggcgcgtcttcttccagcttcatctctcctttctataactttgaccatttttcaggaaaccaagacaacagatgtttaggtacaatgatgggtgcacaacaagatatacttcatgttcctctagcaatggtagagagtggctatggagaagaaagcaacagttttaatggacaggagaagaaaaaaaagaagatgacgagcgagcagctaaagttcctcgagagaagtttccaagaagagataaagctgaatccggacaggaagatgaagctgaatccggacaggaagatgaagctgtccaaagaactggggctgcagccgagacagattgcggtttggttccagaacaggaaagccaggtggaagaacaaacaacttgagcatctctatgaatcactaagacaagagtttgatattgtctctagagaaaaggaattgctacaagaagagctaatacaactgaaatcaatgataagagaggatagttcatgcaagaagaaacaaacctgggaaaaagcctgcagctgaggcaatagtatataagttccacttcagttatatctccaaaatggctcaaatttgtagctttagtcccaaacaagcaacaatttctatggctgattctgttttcctttgtattaagtattgtttaagtgattttcgtgtaaagggttctttactaagttgaagttaatgaagaaacatcgtgattcaagaactctagatccat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]