GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-16 17:01:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_021480895            1047 bp    mRNA    linear   VRT 15-JUN-2017
DEFINITION  PREDICTED: Danio rerio si:dkeyp-2e4.7 (si:dkeyp-2e4.7), transcript
            variant X1, mRNA.
ACCESSION   XM_021480895
VERSION     XM_021480895.1
DBLINK      BioProject: PRJNA13922
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_007124.7) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Danio rerio Annotation Release 106
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1047
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="13"
     gene            1..1047
                     /gene="si:dkeyp-2e4.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 ESTs, 4 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 6 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:108191950"
                     /db_xref="ZFIN:ZDB-GENE-061009-51"
     CDS             155..859
                     /gene="si:dkeyp-2e4.7"
                     /codon_start=1
                     /product="zinc finger protein 626-like"
                     /protein_id="XP_021336570.1"
                     /db_xref="GeneID:108191950"
                     /db_xref="ZFIN:ZDB-GENE-061009-51"
                     /translation="
MKPVIKNEESLQGDPESKSTNNDVETLVLSKTEGSAALFCRRLKYRVKTDETSDQSSSDTDTEDELPISTSPTPGEDFIMRIHTGEAPYVCELCGKAFKRKHWLKEHFYIHTGVKRKRKKRLSCDQCEMKFECSSVLQGHLNKHRGERPFACVQCDKTYFNQHDLNQHLRDCHSEKKHGCYLCGNEFSRRSLLQKHMRIHTGERPYSCPHCEKTFPYKYSFEMHVKGAVCRRDK"
     misc_feature    425..487
                     /gene="si:dkeyp-2e4.7"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    524..586
                     /gene="si:dkeyp-2e4.7"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    <590..832
                     /gene="si:dkeyp-2e4.7"
                     /note="Putative transcriptional repressor regulating G2/M
                     transition [Transcription / Cell division and chromosome
                     partitioning]; Region: SFP1; COG5189"
                     /db_xref="CDD:227516"
     misc_feature    608..670
                     /gene="si:dkeyp-2e4.7"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(623..625,629..631,635..637,641..646,653..658,
                     665..667,707..709,713..715,725..730,737..742,749..751,
                     791..793,797..799,803..805,809..814,821..826)
                     /gene="si:dkeyp-2e4.7"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    692..754
                     /gene="si:dkeyp-2e4.7"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    731..799
                     /gene="si:dkeyp-2e4.7"
                     /note="Zinc-finger double domain; Region: zf-H2C2_2;
                     pfam13465"
                     /db_xref="CDD:433230"
     misc_feature    776..832
                     /gene="si:dkeyp-2e4.7"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      
aaactgcaaaaaagcactggaagaccctcttaaagacctgcggatggcagcaaagcgcctttatgagtcaagtctgcccaaatatcagaagaagaagaagatcgtacaaaacaggacatggcatatgtttgcttgaagtccggactgcatcaatatgaagcctgtgatcaaaaatgaagagtctcttcagggagatccagagtccaaatccactaataatgatgtggaaactttggttctgagtaaaacagaaggatcggctgctctcttttgcagacggctgaaatatcgagtaaaaactgatgaaacatcagatcaaagttcatcagatactgacacagaagatgagcttcccatctccacatctccaactcctggtgaagacttcatcatgcgaatacacacaggagaagcgccctatgtctgtgaactctgtggtaaagcgttcaaacgtaaacactggcttaaagaacacttttacatccatactggtgtcaaacgcaagcgcaagaagagattgagctgtgatcagtgtgaaatgaagtttgagtgctcctctgttcttcaaggtcatttaaataagcacagaggcgagaggccgttcgcctgcgttcagtgcgacaaaacctacttcaatcaacatgatcttaatcaacacctcagagactgtcattcagaaaaaaagcacggctgctatttgtgtggaaatgaattttctcgccgctctttactgcagaaacacatgcggatccacacaggagagagaccttactcctgtccacactgtgagaagactttcccctataaatacagctttgaaatgcatgttaaaggtgctgtatgtaggagagataaatgagatattgtagtacaaatgaaaaatacggaaaaatattcactttgtctctcctatgatgactccatgcaagttgccagattgacgacaatctagttttacactgtgaactgctcagctacttgctgtgtttgtaatatttatattgtttgttaattaaaaaccaccttgtggatttttacaactctgaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]