2024-05-15 11:36:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_001342099 1211 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio putative claudin-24 (LOC100002327), mRNA. ACCESSION XM_001342099 VERSION XM_001342099.4 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007122.7) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Jun 15, 2017 this sequence version replaced XM_001342099.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Danio rerio Annotation Release 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1211 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="11" gene 1..1211 /gene="LOC100002327" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:100002327" CDS 349..1014 /gene="LOC100002327" /codon_start=1 /product="putative claudin-24" /protein_id="XP_001342135.1" /db_xref="GeneID:100002327" /translation="
MEPGSCALELLGVFFSLCACLCSLLSTMMTRWLTLSTELLPTESFELGLWMTCVVQELGVTECRPYDSLLGLPPDIRLARIMMCTSVAAGLSALVFAIPGINLVNSCKNRADSIEAKRTLKIFGGILSLSSGVLGIVPVSYVAHLTVLRFFDESVPSVVPRWEFGDALFLGWTAGCLQVVAGLLLITSCFFLQDKTRGLGESIHMDRVNGTRSPRNRTENV"
misc_feature 367..903 /gene="LOC100002327" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
cgtcttgaccatgtctacatgcctaaatgcactgacataactcacacaattctcagcacttgcagctcttttgtataatcagcactggttgtgtgtattgcctcttcttgctgaattgctgaatgcctcctaaattgaaaatcgctttggtctgcaaaatgactaaatagttttgtagttaatcttgagtctaatccttgcatgtattggtcttcagatcagtgtgtctgtgaaagcagttgttgttcagcccaccagagccactcctcctcatcctcacactaatgctctgctcagcgctcgctctcagtgtctactatctagtgtagacagcagcaggagcagctgatggagccggggtcctgcgctctggagctgctgggagtgttcttctctctgtgcgcctgcttgtgttcgctcctcagcaccatgatgacccgctggctgactctctctactgagttactgccaacagaaagcttcgagctgggattgtggatgacgtgtgtggtccaggagctcggcgtgaccgagtgtcgcccgtacgacagtcttttaggtctgcctcctgatatccggctggctcgcattatgatgtgcacttctgtggccgctggtttgagcgcactagtgttcgccataccgggaataaatctggtgaacagctgcaagaaccgcgctgacagcattgaagccaagcgcactcttaagatctttggcgggatcttgagcttgtcttctggagttttggggatcgtgccggtctcctatgtggcgcatctgacagtgctgcggttcttcgatgagagcgtgcccagtgtggttcctcgctgggagtttggagatgcgctgtttttgggatggaccgctggatgcttgcaggtggtcgccgggttgttgttgatcacatcttgcttctttctgcaagataaaacaaggggtttaggggaatctatacatatggatagagtcaacgggacacgatctccacgcaacaggacagaaaatgtgtgagaagtgttgtccactcatgtattactgaactttataataatgcattgattatttatgatcaaagtacctcatgtagaaatctgatgtatttaaatatatgcaaattatatggcatacaagtttatatttggatttaacatttaaaatgtcaaaatatttcacattgccttttttttttttacaaatatgcacataca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]