2024-05-16 22:09:47, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_178132 1357 bp mRNA linear VRT 11-SEP-2023 DEFINITION Danio rerio NK3 homeobox 2 (nkx3-2), mRNA. ACCESSION NM_178132 VERSION NM_178132.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1357) AUTHORS Watson CJ, Tang WJ, Rojas MF, Fiedler IAK, Morfin Montes de Oca E, Cronrath AR, Callies LK, Swearer AA, Ahmed AR, Sethuraman V, Addish S, Farr GH 3rd, Gomez AE, Rai J, Monstad-Rios AT, Gardiner EM, Karasik D, Maves L, Busse B, Hsu YH and Kwon RY. TITLE wnt16 regulates spine and muscle morphogenesis through parallel signals from notochord and dermomyotome JOURNAL PLoS Genet 18 (11), e1010496 (2022) PUBMED 36346812 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1357) AUTHORS Waldmann L, Leyhr J, Zhang H, Ohman-Magi C, Allalou A and Haitina T. TITLE The broad role of Nkx3.2 in the development of the zebrafish axial skeleton JOURNAL PLoS One 16 (8), e0255953 (2021) PUBMED 34411150 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1357) AUTHORS Castellanos BS, Reyes-Nava NG and Quintana AM. TITLE Knockdown of hspg2 is associated with abnormal mandibular joint formation and neural crest cell dysfunction in zebrafish JOURNAL BMC Dev Biol 21 (1), 7 (2021) PUBMED 33678174 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1357) AUTHORS Smeeton J, Natarajan N, Naveen Kumar A, Miyashita T, Baddam P, Fabian P, Graf D and Crump JG. TITLE Zebrafish model for spondylo-megaepiphyseal-metaphyseal dysplasia reveals post-embryonic roles of Nkx3.2 in the skeleton JOURNAL Development 148 (2) (2021) PUBMED 33462117 REMARK GeneRIF: Zebrafish model for spondylo-megaepiphyseal-metaphyseal dysplasia reveals post-embryonic roles of Nkx3.2 in the skeleton. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1357) AUTHORS Gebuijs IGE, Metz JR, Zethof J, Carels CEL, Wagener FADTG and Von den Hoff JW. TITLE The anti-epileptic drug valproic acid causes malformations in the developing craniofacial skeleton of zebrafish larvae JOURNAL Mech Dev 163, 103632 (2020) PUBMED 32668265 REFERENCE 6 (bases 1 to 1357) AUTHORS Walker MB, Miller CT, Coffin Talbot J, Stock DW and Kimmel CB. TITLE Zebrafish furin mutants reveal intricacies in regulating Endothelin1 signaling in craniofacial patterning JOURNAL Dev Biol 295 (1), 194-205 (2006) PUBMED 16678149 REFERENCE 7 (bases 1 to 1357) AUTHORS Nissen RM, Amsterdam A and Hopkins N. TITLE A zebrafish screen for craniofacial mutants identifies wdr68 as a highly conserved gene required for endothelin-1 expression JOURNAL BMC Dev Biol 6, 28 (2006) PUBMED 16759393 REMARK Publication Status: Online-Only REFERENCE 8 (bases 1 to 1357) AUTHORS Woods IG, Wilson C, Friedlander B, Chang P, Reyes DK, Nix R, Kelly PD, Chu F, Postlethwait JH and Talbot WS. TITLE The zebrafish gene map defines ancestral vertebrate chromosomes JOURNAL Genome Res 15 (9), 1307-1314 (2005) PUBMED 16109975 REFERENCE 9 (bases 1 to 1357) AUTHORS Clouthier DE and Schilling TF. TITLE Understanding endothelin-1 function during craniofacial development in the mouse and zebrafish JOURNAL Birth Defects Res C Embryo Today 72 (2), 190-199 (2004) PUBMED 15269892 REMARK Review article REFERENCE 10 (bases 1 to 1357) AUTHORS Miller CT, Maves L and Kimmel CB. TITLE moz regulates Hox expression and pharyngeal segmental identity in zebrafish JOURNAL Development 131 (10), 2443-2461 (2004) PUBMED 15128673 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AY225416.1. On Jun 3, 2003 this sequence version replaced NM_178132.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AY225416.1, BC162299.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505380 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1357 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="14" /map="14" gene 1..1357 /gene="nkx3-2" /gene_synonym="bapx1; nkx3.2" /note="NK3 homeobox 2" /db_xref="GeneID:337865" /db_xref="ZFIN:ZDB-GENE-030127-1" misc_feature 105..107 /gene="nkx3-2" /gene_synonym="bapx1; nkx3.2" /note="upstream in-frame stop codon" CDS 123..860 /gene="nkx3-2" /gene_synonym="bapx1; nkx3.2" /note="bagpipe homeobox homolog 1" /codon_start=1 /product="homeobox protein Nkx-3.2" /protein_id="NP_835233.1" /db_xref="GeneID:337865" /db_xref="ZFIN:ZDB-GENE-030127-1" /translation="
MAVRSNSLMPFSIQAILNRKEESRHLNELDVCFSKSACWKIFDEMDAPERSDETEHKNYDSDSGLSEDNDAKAQIDAKPEKDADLADETDQESAAKGLSDCVSDCNTAEEKSGDAPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDRRQYSPGELLRPPLLSLQPSYYYPYTYCLPAWSLSSACSGNQ"
misc_feature 315..>653 /gene="nkx3-2" /gene_synonym="bapx1; nkx3.2" /note="Homeodomain-containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature order(483..497,501..503,552..554,570..572,609..611, 615..620,627..632,636..644,648..653) /gene="nkx3-2" /gene_synonym="bapx1; nkx3.2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 489..650 /gene="nkx3-2" /gene_synonym="bapx1; nkx3.2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(489..491,498..500,618..620,627..632,639..641) /gene="nkx3-2" /gene_synonym="bapx1; nkx3.2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN
gcacgagaccaaactccctttacgcgcggcgcgatgcgaccgaactgcggccacggagctcgatggaccgcgtaatcttaaccctaatgctccgcgacccggtctgactagtgctgctcgacatggctgtgcgcagtaactctctgatgccattctcaattcaagccattctgaaccgaaaagaggagtctcgccatctgaacgagctggatgtgtgtttctcaaagagcgcgtgctggaaaatattcgatgaaatggacgcaccggagcggagcgacgaaacggagcataagaactacgattccgactccgggctgagcgaggacaacgacgctaaagcgcaaatcgacgcaaagccagaaaaagacgcagatttagcggacgagacggatcaggaatccgcggccaagggcctgagcgactgcgtgtccgactgtaacacggccgaggagaagagcggcgatgcgccgaagcagcggaagaagcgctcccgggccgcgttctcccacgcgcaggtgttcgagctcgagcgccgcttcaaccaccagcgttatctctccggaccggagcgcgcagacctcgcggcctccctcaaactcaccgagacgcaggtcaagatctggttccagaatcgacggtacaaaaccaagcgacgtcagatggccgccgatctgctggcgtcagccccggcggcgaagaaagtggcggtgaaggtgctggtccgggacgaccgacggcagtacagccccggggagttgctgcgaccgccgcttctgtcgctgcagccctcttattattacccgtacacgtactgcctgcccgcctggagcctgtcctccgcctgctctggaaaccagtgacaccaggactctccgacccatatttattacgcgaaagactttcgtttaccgaacacgccgagtgagcaaccaaaaccgggagatgttattcagtggaactgtcttcaccgaaacagactcgttatctccaggactgctgatgtgctcctgattaactctattaggattctatctcagaatgtgtggaaatgtgtcattcccggctcgtgttttagcgaaatgttcgttcttctggttggaaaacaaagcagcacttgatgccgttactgccgttcggttttagggtataaacggtaagactggcactttccccctccacagttccacatgttaaaatcagaagaaaatattgaacatttgctggacttgaggagccgtgaaggctcgcccgtttactagacatgtacttgttttcatattggtgtatcgtgttttgtttaatgaaaaagaaatgaagcattaaaaggtatgaagaataaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]