2024-05-15 19:44:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131769 1681 bp mRNA linear VRT 08-OCT-2023 DEFINITION Danio rerio claudin j (cldnj), mRNA. ACCESSION NM_131769 VERSION NM_131769.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1681) AUTHORS Lu J, Liu R, Miao A, Chen X, Xiao W, Wang Y, Cao D, Pan J, Li L and Luo Y. TITLE The role of cldnh during the early retinal development in zebrafish JOURNAL Exp Eye Res 200, 108207 (2020) PUBMED 32866532 REMARK GeneRIF: The role of cldnh during the early retinal development in zebrafish. REFERENCE 2 (bases 1 to 1681) AUTHORS Conant GC. TITLE The lasting after-effects of an ancient polyploidy on the genomes of teleosts JOURNAL PLoS One 15 (4), e0231356 (2020) PUBMED 32298330 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1681) AUTHORS Li X, Song G, Zhao Y, Zhao F, Liu C, Liu D, Li Q and Cui Z. TITLE Claudin7b is required for the formation and function of inner ear in zebrafish JOURNAL J Cell Physiol 233 (4), 3195-3206 (2018) PUBMED 28834538 REFERENCE 4 (bases 1 to 1681) AUTHORS Shu Y, Lou Q, Dai Z, Dai X, He J, Hu W and Yin Z. TITLE The basal function of teleost prolactin as a key regulator on ion uptake identified with zebrafish knockout models JOURNAL Sci Rep 6, 18597 (2016) PUBMED 26726070 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1681) AUTHORS Baltzegar DA, Reading BJ, Brune ES and Borski RJ. TITLE Phylogenetic revision of the claudin gene family JOURNAL Mar Genomics 11, 17-26 (2013) PUBMED 23726886 REFERENCE 6 (bases 1 to 1681) AUTHORS Kumai Y, Bahubeshi A, Steele S and Perry SF. TITLE Strategies for maintaining Na balance in zebrafish (Danio rerio) during prolonged exposure to acidic water JOURNAL Comp Biochem Physiol A Mol Integr Physiol 160 (1), 52-62 (2011) PUBMED 21600298 REFERENCE 7 (bases 1 to 1681) AUTHORS Han Y, Mu Y, Li X, Xu P, Tong J, Liu Z, Ma T, Zeng G, Yang S, Du J and Meng A. TITLE Grhl2 deficiency impairs otic development and hearing ability in a zebrafish model of the progressive dominant hearing loss DFNA28 JOURNAL Hum Mol Genet 20 (16), 3213-3226 (2011) PUBMED 21610158 REFERENCE 8 (bases 1 to 1681) AUTHORS Clelland ES and Kelly SP. TITLE Tight junction proteins in zebrafish ovarian follicles: stage specific mRNA abundance and response to 17beta-estradiol, human chorionic gonadotropin, and maturation inducing hormone JOURNAL Gen Comp Endocrinol 168 (3), 388-400 (2010) PUBMED 20553723 REFERENCE 9 (bases 1 to 1681) AUTHORS Hardison AL, Lichten L, Banerjee-Basu S, Becker TS and Burgess SM. TITLE The zebrafish gene claudinj is essential for normal ear function and important for the formation of the otoliths JOURNAL Mech Dev 122 (7-8), 949-958 (2005) PUBMED 15925497 REMARK GeneRIF: Morpholino inhibition of claudinj expression showed similar defects in otolith formation. REFERENCE 10 (bases 1 to 1681) AUTHORS Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B. TITLE Extensive expansion of the claudin gene family in the teleost fish, Fugu rubripes JOURNAL Genome Res 14 (7), 1248-1257 (2004) PUBMED 15197168 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CR382327.27. On May 31, 2017 this sequence version replaced NM_131769.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1681 CR382327.27 102963-104643 FEATURES Location/Qualifiers source 1..1681 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="15" /map="15" gene 1..1681 /gene="cldnj" /gene_synonym="cldn8l; fc30g01; wu:fc30g01" /note="claudin j" /db_xref="GeneID:81589" /db_xref="ZFIN:ZDB-GENE-010328-10" exon 1..1681 /gene="cldnj" /gene_synonym="cldn8l; fc30g01; wu:fc30g01" /inference="alignment:Splign:2.1.0" CDS 34..666 /gene="cldnj" /gene_synonym="cldn8l; fc30g01; wu:fc30g01" /codon_start=1 /product="claudin j" /protein_id="NP_571844.2" /db_xref="GeneID:81589" /db_xref="ZFIN:ZDB-GENE-010328-10" /translation="
MALQVLGITLSMIGFAGTIIICALPMWKVTAFIGTNIVVAQVFWEGLWMTCVYERIGQMQCKLYDALLDLDPFLQASRGLIVTTMALASLAFLIFLIGADCTNCLSNPRAKGRIVVVSGITFMLSGLTTVVPVSWTADSIIRDFHNPVVHEALKREMGAALYVGWLTAGFLFIGGAILCTSCPPERDNYLPRYTLTKSGTHSGYAVKNYV"
misc_feature 34..567 /gene="cldnj" /gene_synonym="cldn8l; fc30g01; wu:fc30g01" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
ttcttgtctctgtggtctccagcccgctcctccatggctctgcaggttttgggaatcactctgtcaatgatcggctttgcgggaaccatcatcatctgcgcgctgcccatgtggaaggtgaccgccttcattggcaccaacatcgtggtggctcaggtgttttgggaaggcctgtggatgacctgtgtgtatgagcgcatcggccagatgcagtgcaaactctatgacgccctgctggatttggaccccttcctgcaggcgtcccgcgggctcatagtgaccaccatggctttggccagcttggctttcctcatttttctgattggggctgattgcactaactgtctgagtaacccacgggccaaaggacggattgtggtggtctccggcatcacctttatgctttcaggactgaccactgtggtgcccgtgtcctggacagccgactccattataagggactttcacaatcctgtagtgcacgaggctttaaagagggagatgggagcagctctttatgtgggctggttaacagccgggtttctgtttattggtggagcaattctgtgcaccagttgcccaccggagcgggacaactatttaccacggtatactttaacaaaatctggcactcacagtggctatgctgtaaagaactatgtctgacaggtaacactctctaaaatagtagactgaacaaaaattattggatttcctagtttttttttagggtaaactattcatttgggctgaatttaaacaaaaaaggtgattttagtaatcaacttaatttgagtgcgtttatattcagctcgtatgaattgtttgcaaccatttaccctaaaaaatgtagtaaatccaatgaatatttttttgtgtgtattgcacaagtgttatgctgcatccacaccagacgcggaacgcgattcaagcgtgagtgatttacatgttaagtcaatgcaaacacgcaaatagacatcctgcgaatggcgcgacgcaaattgaacgttttgcgcgttaaacaaccaggagcttgcacttgtggaggtgtgattgtgacgtatcccctgttgtcggtgttccgggggaaatccttcagccgaaaccgacaaaaagttcatcaaactgtgctcagcgcagtcagaagcaccgctgaaagcctccatcagccaggttaagtttctggaggagtttatgagctcacagagctggatgcacatctgaaagaatctagtggactcagacacgaccctaaacgtatcgacgctgtttttcagccttcataaagcacattaacactgttatttttttaataaaatccatgttagccatttagctatgaagctagagtcaccgggcagacagaagccctgcccatcacgcgaatccgcgtctgttctgaagtgaatttgacgcgcgaatgaagcagatttgatgtgcgaatgaagcgagtaacctcaaatgttcacgctgctatttacgcgcaaatagcacgatttatcggtgcgttctgcgtctggtgtgaacacagcattaaaggaatgctttactcaccctttccttaaaatgtaagtttttgtattctgttgaacgctaaggaagatatttgaagaatgccagaaaccagtaaccattgacatccatagtaggaaaaacaaatacagttgaaaccagaagttta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]