GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-17 00:55:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_131589               1175 bp    mRNA    linear   VRT 20-FEB-2022
DEFINITION  Danio rerio NK2 homeobox 4b (nkx2.4b), mRNA.
ACCESSION   NM_131589
VERSION     NM_131589.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1175)
  AUTHORS   Yan YL, Titus T, Desvignes T, BreMiller R, Batzel P, Sydes J,
            Farnsworth D, Dillon D, Wegner J, Phillips JB, Peirce J, Dowd J,
            Buck CL, Miller A, Westerfield M and Postlethwait JH.
  CONSRTM   Undiagnosed Diseases Network
  TITLE     A fish with no sex: gonadal and adrenal functions partition between
            zebrafish NR5A1 co-orthologs
  JOURNAL   Genetics 217 (2) (2021)
   PUBMED   33724412
  REMARK    Erratum:[Genetics. 2021 May 17;218(1):. PMID: 33826717]
REFERENCE   2  (bases 1 to 1175)
  AUTHORS   Chu S, Kwon BR, Lee YM, Zoh KD and Choi K.
  TITLE     Effects of 2-ethylhexyl-4-methoxycinnamate (EHMC) on thyroid
            hormones and genes associated with thyroid, neurotoxic, and
            nephrotoxic responses in adult and larval zebrafish (Danio rerio)
  JOURNAL   Chemosphere 263, 128176 (2021)
   PUBMED   33297144
REFERENCE   3  (bases 1 to 1175)
  AUTHORS   Kim J, Lee G, Lee YM, Zoh KD and Choi K.
  TITLE     Thyroid disrupting effects of perfluoroundecanoic acid and
            perfluorotridecanoic acid in zebrafish (Danio rerio) and rat
            pituitary (GH3) cell line
  JOURNAL   Chemosphere 262, 128012 (2021)
   PUBMED   33182161
REFERENCE   4  (bases 1 to 1175)
  AUTHORS   Chen X, Teng M, Zhang J, Qian L, Duan M, Cheng Y, Zhao F, Zheng J
            and Wang C.
  TITLE     Tralopyril induces developmental toxicity in zebrafish embryo
            (Danio rerio) by disrupting the thyroid system and metabolism
  JOURNAL   Sci Total Environ 746, 141860 (2020)
   PUBMED   33027873
REFERENCE   5  (bases 1 to 1175)
  AUTHORS   Lee S, Eghan K, Lee J, Yoo D, Yoon S and Kim WK.
  TITLE     Zebrafish Embryonic Exposure to BPAP and Its Relatively Weak
            Thyroid Hormone-Disrupting Effects
  JOURNAL   Toxics 8 (4), E103 (2020)
   PUBMED   33202880
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1175)
  AUTHORS   Elsalini OA and Rohr KB.
  TITLE     Phenylthiourea disrupts thyroid function in developing zebrafish
  JOURNAL   Dev Genes Evol 212 (12), 593-598 (2003)
   PUBMED   12536323
REFERENCE   7  (bases 1 to 1175)
  AUTHORS   Mathieu J, Barth A, Rosa FM, Wilson SW and Peyrieras N.
  TITLE     Distinct and cooperative roles for Nodal and Hedgehog signals
            during hypothalamic development
  JOURNAL   Development 129 (13), 3055-3065 (2002)
   PUBMED   12070082
  REMARK    GeneRIF: There exists cooperation between Nodal and Hedgehog
            pathways in the maintenance of the anterior-dorsal hypothalamus.
REFERENCE   8  (bases 1 to 1175)
  AUTHORS   Rohr KB, Barth KA, Varga ZM and Wilson SW.
  TITLE     The nodal pathway acts upstream of hedgehog signaling to specify
            ventral telencephalic identity
  JOURNAL   Neuron 29 (2), 341-351 (2001)
   PUBMED   11239427
REFERENCE   9  (bases 1 to 1175)
  AUTHORS   Shanmugalingam S, Houart C, Picker A, Reifers F, Macdonald R, Barth
            A, Griffin K, Brand M and Wilson SW.
  TITLE     Ace/Fgf8 is required for forebrain commissure formation and
            patterning of the telencephalon
  JOURNAL   Development 127 (12), 2549-2561 (2000)
   PUBMED   10821754
REFERENCE   10 (bases 1 to 1175)
  AUTHORS   Barth KA, Kishimoto Y, Rohr KB, Seydler C, Schulte-Merker S and
            Wilson SW.
  TITLE     Bmp activity establishes a gradient of positional information
            throughout the entire neural plate
  JOURNAL   Development 126 (22), 4977-4987 (1999)
   PUBMED   10529416
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF253054.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF253054.1, BC162307.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505371, SAMEA3505372
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1175
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="20"
                     /map="20"
     gene            1..1175
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /note="NK2 homeobox 4b"
                     /db_xref="GeneID:58112"
                     /db_xref="ZFIN:ZDB-GENE-000830-1"
     exon            1..377
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    29..31
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /note="upstream in-frame stop codon"
     CDS             35..958
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /note="thyroid transcription factor 1a; NK2 homeobox 1a;
                     NK2 homeobox 2.4b"
                     /codon_start=1
                     /product="NK2 homeobox 4b"
                     /protein_id="NP_571664.1"
                     /db_xref="GeneID:58112"
                     /db_xref="ZFIN:ZDB-GENE-000830-1"
                     /translation="
MSLSPKHSTPFSVSDILSPIEETFKKFAAMESSASLASPLYRQSQVSQANLQQHSMSHNAYHMPHSQFSHSTMGGYCNGTIGAMGDLPSYQESMRNGATATAWYGSNPEPRYPTISRFMGPSAGMNMGTLPGMDASKSMVTLHAAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKASQQQDSGNMCAQQSPRRVALPVLVKDGKPCQNGSGTPTPIHQQVQSVLGSETLASAEDLEEMSPSPPLMGGLSQTDAALIEYTSSMVSSNLLYGRTW"
     misc_feature    order(476..490,494..496,545..547,563..565,602..604,
                     608..613,620..625,629..637,641..646)
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    482..643
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(482..484,491..493,611..613,620..625,632..634)
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            378..1152
                     /gene="nkx2.4b"
                     /gene_synonym="nk2.1a; nkx2.1; nkx2.1a; nkx2.4a; titf1;
                     titf1a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggcagcttcagcaaacctgctcgcgggctgaaccatgtccttgagccccaaacactcaacgcctttctcagtgagcgatattttgagcccgatcgaggagaccttcaagaagtttgcagccatggagagcagcgcgagcctggcgtctcctctatatcgacagagtcaggtgtctcaggctaatttgcagcagcacagcatgagccataacgcgtaccacatgccgcactcgcagttctcgcatagcaccatgggcggatattgcaacgggactatcggtgcaatgggggacctgccatcctaccaggagagcatgagaaacggcgccacggccacggcttggtacggctcgaacccggagccgagatacccaacaatctccaggtttatgggtccctcggcgggcatgaacatgggcacgttaccgggaatggacgccagtaaatctatggtaactctacacgcggcgccgcgcaggaaacggcgcgtgcttttctcccaagcgcaggtatacgagctggagcgccgcttcaagcagcaaaaatacctgtcggccccggagagggaacatttggccagcatgatccatctaaccccgacgcaggtcaagatctggttccagaaccacaggtacaaaatgaagcggcaggcgaaggataaagcgtcccagcagcaggacagcgggaacatgtgcgcgcagcagtcgccaaggcgcgtggccctgcctgtgcttgttaaggacggtaaaccgtgtcagaacggctccggcacgccgacgccgatccatcaacaggtgcaaagcgtcctgggcagcgagactttagcttcagccgaggatctggaggaaatgtcgcctagtccgcctctgatgggcggcctctctcagactgacgccgcgctcatcgagtacacgagcagcatggtgagctccaacctgctgtacggcagaacatggtgatatttcacaaactacaacaacaacaaaaaaaaatcctcatttttaatcaactgacggacggagatatgtgcatttccacaaagacctttttttaaagaattgtttttttattttacgcacttgctttttggtgcaggagcctctttgacgtgaattgtatacggatttgtgagtttaaatcattattgactgaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]