2024-05-16 19:49:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131300 1215 bp mRNA linear VRT 16-SEP-2023 DEFINITION Danio rerio distal-less homeobox 4a (dlx4a), mRNA. ACCESSION NM_131300 XM_005163982 VERSION NM_131300.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1215) AUTHORS Xia Z, Bi X, Yang S, Yang X, Song Z, Wei J, Xu P, Rink L, Min J and Wang F. TITLE Metal transporter Slc30a1 controls pharyngeal neural crest differentiation via the zinc-Snai2-Jag1 cascade JOURNAL MedComm (2020) 2 (4), 778-797 (2021) PUBMED 34977877 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1215) AUTHORS Jia S, Wu X, Wu Y, Cui X, Tao B, Zhu Z and Hu W. TITLE Multiple Developmental Defects in sox11a Mutant Zebrafish with Features of Coffin-Siris Syndrome JOURNAL Int J Biol Sci 16 (15), 3039-3049 (2020) PUBMED 33061816 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1215) AUTHORS Sharma PP, MacLean AL, Meinecke L, Clouthier DE, Nie Q and Schilling TF. TITLE Transcriptomics reveals complex kinetics of dorsal-ventral patterning gene expression in the mandibular arch JOURNAL Genesis 57 (1), e23275 (2019) PUBMED 30561090 REFERENCE 4 (bases 1 to 1215) AUTHORS Sedykh I, Yoon B, Roberson L, Moskvin O, Dewey CN and Grinblat Y. TITLE Zebrafish zic2 controls formation of periocular neural crest and choroid fissure morphogenesis JOURNAL Dev Biol 429 (1), 92-104 (2017) PUBMED 28689736 REFERENCE 5 (bases 1 to 1215) AUTHORS Askary A, Xu P, Barske L, Bay M, Bump P, Balczerski B, Bonaguidi MA and Crump JG. TITLE Genome-wide analysis of facial skeletal regionalization in zebrafish JOURNAL Development 144 (16), 2994-3005 (2017) PUBMED 28705894 REFERENCE 6 (bases 1 to 1215) AUTHORS Verreijdt L, Debiais-Thibaud M, Borday-Birraux V, Van der Heyden C, Sire JY and Huysseune A. TITLE Expression of the dlx gene family during formation of the cranial bones in the zebrafish (Danio rerio): differential involvement in the visceral skeleton and braincase JOURNAL Dev Dyn 235 (5), 1371-1389 (2006) PUBMED 16534783 REFERENCE 7 (bases 1 to 1215) AUTHORS Borday-Birraux V, Van der Heyden C, Debiais-Thibaud M, Verreijdt L, Stock DW, Huysseune A and Sire JY. TITLE Expression of Dlx genes during the development of the zebrafish pharyngeal dentition: evolutionary implications JOURNAL Evol Dev 8 (2), 130-141 (2006) PUBMED 16509892 REFERENCE 8 (bases 1 to 1215) AUTHORS Whitehead GG, Makino S, Lien CL and Keating MT. TITLE fgf20 is essential for initiating zebrafish fin regeneration JOURNAL Science 310 (5756), 1957-1960 (2005) PUBMED 16373575 REFERENCE 9 (bases 1 to 1215) AUTHORS Woods IG, Wilson C, Friedlander B, Chang P, Reyes DK, Nix R, Kelly PD, Chu F, Postlethwait JH and Talbot WS. TITLE The zebrafish gene map defines ancestral vertebrate chromosomes JOURNAL Genome Res 15 (9), 1307-1314 (2005) PUBMED 16109975 REFERENCE 10 (bases 1 to 1215) AUTHORS Amores A, Force A, Yan YL, Joly L, Amemiya C, Fritz A, Ho RK, Langeland J, Prince V, Wang YL, Westerfield M, Ekker M and Postlethwait JH. TITLE Zebrafish hox clusters and vertebrate genome evolution JOURNAL Science 282 (5394), 1711-1714 (1998) PUBMED 9831563 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from EH441414.1, EH591391.1 and AL590145.3. On or before Feb 18, 2016 this sequence version replaced XM_005163982.2, NM_131300.1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: GDQH01022456.1, GFIL01008706.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA2168446, SAMEA2168447 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-43 EH441414.1 26-68 44-291 EH591391.1 30-277 292-488 AL590145.3 133300-133496 c 489-915 EH591391.1 475-901 916-1215 AL590145.3 122422-122721 c FEATURES Location/Qualifiers source 1..1215 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="3" /map="3" gene 1..1215 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="distal-less homeobox 4a" /db_xref="GeneID:30561" /db_xref="ZFIN:ZDB-GENE-980526-73" exon 1..498 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /inference="alignment:Splign:2.1.0" misc_feature 189..191 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="upstream in-frame stop codon" CDS 195..947 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="distal-less homeobox protein 4a; distal-less homeobox gene 8; distal-less homeobox gene 4a" /codon_start=1 /product="homeobox protein Dlx4a" /protein_id="NP_571375.1" /db_xref="GeneID:30561" /db_xref="ZFIN:ZDB-GENE-980526-73" /translation="
MTMTSLSESLEASDPSKSAFLEFSHGYQSHQQHSPGVSHAHYPVHGLHQGAHSQYDAAFSPGAASYSRPLAYHYSTAHHHPGAYLPYQHNSAVGYSRVEDADSEKQSSIESGEIRLNGKGKKIRKPRTIYSSLQLQALNQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPEGEHLQAASASGAPCSPGMPPLWDVSMPSKGAPIHSGGYMNSFGHWYSGHHQDPMARTQMM"
misc_feature 486..812 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="Homeodomain-containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature order(564..578,582..584,633..635,651..653,690..692, 696..701,708..713,717..725,729..734) /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 570..731 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(570..572,579..581,699..701,708..713,720..722) /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 738..800 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /note="propagated from UniProtKB/Swiss-Prot (Q98879.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 499..692 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /inference="alignment:Splign:2.1.0" exon 693..1215 /gene="dlx4a" /gene_synonym="DLX-8; dlx8" /inference="alignment:Splign:2.1.0" ORIGIN
gaatcaactcagtatgtgacgacgctgttgagatgaagttctcagacttcacacacggccaaaacgaaagcaaacgcaccagccccacggacatggatctctttgatggccctctttaagagatggaaattacatgacttctaaatagatgccacttttatggtgcaccggtctaatggacataactctaaaacatgactatgacttcattgtctgaaagtttggaggcttcagatccctcaaagtcggcttttctggagttcagtcacggttaccagtctcaccagcagcattcacccggtgtgtctcacgcgcactatccggtgcacggtttgcatcaaggcgcgcattcgcaatacgacgcggccttctctcctggcgctgcgtcttacagccgtccactcgcttaccactattccaccgcacaccaccatccaggagcttacctaccctatcaacacaacagcgcagtcggatattcaagagttgaggatgcagattccgagaagcaaagttccattgaaagtggagaaatacggctgaacgggaaggggaagaagattcgcaaaccgcgcacgatttactcgagcttacagctgcaggcgctcaaccagcgcttccagcaaacccagtacctcgcgctgcccgaacgcgctgatctggcggctaaactgggtctgacacaaacacaggtcaagatatggttccagaacaagcgttccaagtacaaaaagatcatgaaacatggctcaagtggacctgaaggagaacaccttcaagcagcgtctgcttcaggagccccatgttcaccaggcatgccacccctatgggatgtttccatgcccagcaaaggtgctcccatccactctggaggatatatgaactctttcggacactggtactcgggtcatcatcaagacccaatggccagaactcagatgatgtgatgggacgtttagaacaatctacagtgtttccacgtcccatctactgattccagcagttcacaccagcactctttagcactgcgtactccgccaaacatccttcccagtattttcctcataaagatttacattgctgacattttggtttatttgcttgcaggtttttgtggtggatttaaaaaaaaaagactgaataaacagcctaacctgaacttggatttttgtatgttcttgtaaatttgaataaaatgcctttgtctgattgtca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]