GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-16 19:49:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_131300               1215 bp    mRNA    linear   VRT 16-SEP-2023
DEFINITION  Danio rerio distal-less homeobox 4a (dlx4a), mRNA.
ACCESSION   NM_131300 XM_005163982
VERSION     NM_131300.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1215)
  AUTHORS   Xia Z, Bi X, Yang S, Yang X, Song Z, Wei J, Xu P, Rink L, Min J and
            Wang F.
  TITLE     Metal transporter Slc30a1 controls pharyngeal neural crest
            differentiation via the zinc-Snai2-Jag1 cascade
  JOURNAL   MedComm (2020) 2 (4), 778-797 (2021)
   PUBMED   34977877
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1215)
  AUTHORS   Jia S, Wu X, Wu Y, Cui X, Tao B, Zhu Z and Hu W.
  TITLE     Multiple Developmental Defects in sox11a Mutant Zebrafish with
            Features of Coffin-Siris Syndrome
  JOURNAL   Int J Biol Sci 16 (15), 3039-3049 (2020)
   PUBMED   33061816
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1215)
  AUTHORS   Sharma PP, MacLean AL, Meinecke L, Clouthier DE, Nie Q and
            Schilling TF.
  TITLE     Transcriptomics reveals complex kinetics of dorsal-ventral
            patterning gene expression in the mandibular arch
  JOURNAL   Genesis 57 (1), e23275 (2019)
   PUBMED   30561090
REFERENCE   4  (bases 1 to 1215)
  AUTHORS   Sedykh I, Yoon B, Roberson L, Moskvin O, Dewey CN and Grinblat Y.
  TITLE     Zebrafish zic2 controls formation of periocular neural crest and
            choroid fissure morphogenesis
  JOURNAL   Dev Biol 429 (1), 92-104 (2017)
   PUBMED   28689736
REFERENCE   5  (bases 1 to 1215)
  AUTHORS   Askary A, Xu P, Barske L, Bay M, Bump P, Balczerski B, Bonaguidi MA
            and Crump JG.
  TITLE     Genome-wide analysis of facial skeletal regionalization in
            zebrafish
  JOURNAL   Development 144 (16), 2994-3005 (2017)
   PUBMED   28705894
REFERENCE   6  (bases 1 to 1215)
  AUTHORS   Verreijdt L, Debiais-Thibaud M, Borday-Birraux V, Van der Heyden C,
            Sire JY and Huysseune A.
  TITLE     Expression of the dlx gene family during formation of the cranial
            bones in the zebrafish (Danio rerio): differential involvement in
            the visceral skeleton and braincase
  JOURNAL   Dev Dyn 235 (5), 1371-1389 (2006)
   PUBMED   16534783
REFERENCE   7  (bases 1 to 1215)
  AUTHORS   Borday-Birraux V, Van der Heyden C, Debiais-Thibaud M, Verreijdt L,
            Stock DW, Huysseune A and Sire JY.
  TITLE     Expression of Dlx genes during the development of the zebrafish
            pharyngeal dentition: evolutionary implications
  JOURNAL   Evol Dev 8 (2), 130-141 (2006)
   PUBMED   16509892
REFERENCE   8  (bases 1 to 1215)
  AUTHORS   Whitehead GG, Makino S, Lien CL and Keating MT.
  TITLE     fgf20 is essential for initiating zebrafish fin regeneration
  JOURNAL   Science 310 (5756), 1957-1960 (2005)
   PUBMED   16373575
REFERENCE   9  (bases 1 to 1215)
  AUTHORS   Woods IG, Wilson C, Friedlander B, Chang P, Reyes DK, Nix R, Kelly
            PD, Chu F, Postlethwait JH and Talbot WS.
  TITLE     The zebrafish gene map defines ancestral vertebrate chromosomes
  JOURNAL   Genome Res 15 (9), 1307-1314 (2005)
   PUBMED   16109975
REFERENCE   10 (bases 1 to 1215)
  AUTHORS   Amores A, Force A, Yan YL, Joly L, Amemiya C, Fritz A, Ho RK,
            Langeland J, Prince V, Wang YL, Westerfield M, Ekker M and
            Postlethwait JH.
  TITLE     Zebrafish hox clusters and vertebrate genome evolution
  JOURNAL   Science 282 (5394), 1711-1714 (1998)
   PUBMED   9831563
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            EH441414.1, EH591391.1 and AL590145.3.
            
            On or before Feb 18, 2016 this sequence version replaced
            XM_005163982.2, NM_131300.1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: GDQH01022456.1, GFIL01008706.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-43                EH441414.1         26-68
            44-291              EH591391.1         30-277
            292-488             AL590145.3         133300-133496       c
            489-915             EH591391.1         475-901
            916-1215            AL590145.3         122422-122721       c
FEATURES             Location/Qualifiers
     source          1..1215
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="3"
                     /map="3"
     gene            1..1215
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="distal-less homeobox 4a"
                     /db_xref="GeneID:30561"
                     /db_xref="ZFIN:ZDB-GENE-980526-73"
     exon            1..498
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    189..191
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="upstream in-frame stop codon"
     CDS             195..947
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="distal-less homeobox protein 4a; distal-less
                     homeobox gene 8; distal-less homeobox gene 4a"
                     /codon_start=1
                     /product="homeobox protein Dlx4a"
                     /protein_id="NP_571375.1"
                     /db_xref="GeneID:30561"
                     /db_xref="ZFIN:ZDB-GENE-980526-73"
                     /translation="
MTMTSLSESLEASDPSKSAFLEFSHGYQSHQQHSPGVSHAHYPVHGLHQGAHSQYDAAFSPGAASYSRPLAYHYSTAHHHPGAYLPYQHNSAVGYSRVEDADSEKQSSIESGEIRLNGKGKKIRKPRTIYSSLQLQALNQRFQQTQYLALPERADLAAKLGLTQTQVKIWFQNKRSKYKKIMKHGSSGPEGEHLQAASASGAPCSPGMPPLWDVSMPSKGAPIHSGGYMNSFGHWYSGHHQDPMARTQMM"
     misc_feature    486..812
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="Homeodomain-containing transcription factor
                     [Transcription]; Region: COG5576"
                     /db_xref="CDD:227863"
     misc_feature    order(564..578,582..584,633..635,651..653,690..692,
                     696..701,708..713,717..725,729..734)
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    570..731
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(570..572,579..581,699..701,708..713,720..722)
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    738..800
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /note="propagated from UniProtKB/Swiss-Prot (Q98879.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            499..692
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /inference="alignment:Splign:2.1.0"
     exon            693..1215
                     /gene="dlx4a"
                     /gene_synonym="DLX-8; dlx8"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gaatcaactcagtatgtgacgacgctgttgagatgaagttctcagacttcacacacggccaaaacgaaagcaaacgcaccagccccacggacatggatctctttgatggccctctttaagagatggaaattacatgacttctaaatagatgccacttttatggtgcaccggtctaatggacataactctaaaacatgactatgacttcattgtctgaaagtttggaggcttcagatccctcaaagtcggcttttctggagttcagtcacggttaccagtctcaccagcagcattcacccggtgtgtctcacgcgcactatccggtgcacggtttgcatcaaggcgcgcattcgcaatacgacgcggccttctctcctggcgctgcgtcttacagccgtccactcgcttaccactattccaccgcacaccaccatccaggagcttacctaccctatcaacacaacagcgcagtcggatattcaagagttgaggatgcagattccgagaagcaaagttccattgaaagtggagaaatacggctgaacgggaaggggaagaagattcgcaaaccgcgcacgatttactcgagcttacagctgcaggcgctcaaccagcgcttccagcaaacccagtacctcgcgctgcccgaacgcgctgatctggcggctaaactgggtctgacacaaacacaggtcaagatatggttccagaacaagcgttccaagtacaaaaagatcatgaaacatggctcaagtggacctgaaggagaacaccttcaagcagcgtctgcttcaggagccccatgttcaccaggcatgccacccctatgggatgtttccatgcccagcaaaggtgctcccatccactctggaggatatatgaactctttcggacactggtactcgggtcatcatcaagacccaatggccagaactcagatgatgtgatgggacgtttagaacaatctacagtgtttccacgtcccatctactgattccagcagttcacaccagcactctttagcactgcgtactccgccaaacatccttcccagtattttcctcataaagatttacattgctgacattttggtttatttgcttgcaggtttttgtggtggatttaaaaaaaaaagactgaataaacagcctaacctgaacttggatttttgtatgttcttgtaaatttgaataaaatgcctttgtctgattgtca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]