2024-05-16 14:04:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_131120 1821 bp mRNA linear VRT 30-SEP-2023 DEFINITION Danio rerio homeobox B8a (hoxb8a), mRNA. ACCESSION NM_131120 VERSION NM_131120.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1821) AUTHORS Mukaigasa K, Sakuma C and Yaginuma H. TITLE The developmental hourglass model is applicable to the spinal cord based on single-cell transcriptomes and non-conserved cis-regulatory elements JOURNAL Dev Growth Differ 63 (7), 372-391 (2021) PUBMED 34473348 REFERENCE 2 (bases 1 to 1821) AUTHORS Yamada K, Maeno A, Araki S, Kikuchi M, Suzuki M, Ishizaka M, Satoh K, Akama K, Kawabe Y, Suzuki K, Kobayashi D, Hamano N and Kawamura A. TITLE An atlas of seven zebrafish hox cluster mutants provides insights into sub/neofunctionalization of vertebrate Hox clusters JOURNAL Development 148 (11) (2021) PUBMED 34096572 REFERENCE 3 (bases 1 to 1821) AUTHORS Lu CJ, Fan XY, Guo YF, Cheng ZC, Dong J, Chen JZ, Li LY, Wang MW, Wu ZK, Wang F, Tong XJ, Luo LF, Tang FC, Zhu ZY and Zhang B. TITLE Single-cell analyses identify distinct and intermediate states of zebrafish pancreatic islet development JOURNAL J Mol Cell Biol 11 (6), 435-447 (2019) PUBMED 30407522 REFERENCE 4 (bases 1 to 1821) AUTHORS Lan Y, Pan H, Li C, Banks KM, Sam J, Ding B, Elemento O, Goll MG and Evans T. TITLE TETs Regulate Proepicardial Cell Migration through Extracellular Matrix Organization during Zebrafish Cardiogenesis JOURNAL Cell Rep 26 (3), 720-732 (2019) PUBMED 30650362 REFERENCE 5 (bases 1 to 1821) AUTHORS Malmstrom M, Britz R, Matschiner M, Torresen OK, Hadiaty RK, Yaakob N, Tan HH, Jakobsen KS, Salzburger W and Ruber L. TITLE The Most Developmentally Truncated Fishes Show Extensive Hox Gene Loss and Miniaturized Genomes JOURNAL Genome Biol Evol 10 (4), 1088-1103 (2018) PUBMED 29684203 REFERENCE 6 (bases 1 to 1821) AUTHORS Kurosawa G, Takamatsu N, Takahashi M, Sumitomo M, Sanaka E, Yamada K, Nishii K, Matsuda M, Asakawa S, Ishiguro H, Miura K, Kurosawa Y, Shimizu N, Kohara Y and Hori H. TITLE Organization and structure of hox gene loci in medaka genome and comparison with those of pufferfish and zebrafish genomes JOURNAL Gene 370, 75-82 (2006) PUBMED 16472944 REMARK Erratum:[Gene. 2006 Jul;376(2):298-9] REFERENCE 7 (bases 1 to 1821) AUTHORS Phillips RB, Amores A, Morasch MR, Wilson C and Postlethwait JH. TITLE Assignment of zebrafish genetic linkage groups to chromosomes JOURNAL Cytogenet Genome Res 114 (2), 155-162 (2006) PUBMED 16825768 REFERENCE 8 (bases 1 to 1821) AUTHORS Corredor-Adamez M, Welten MC, Spaink HP, Jeffery JE, Schoon RT, de Bakker MA, Bagowski CP, Meijer AH, Verbeek FJ and Richardson MK. TITLE Genomic annotation and transcriptome analysis of the zebrafish (Danio rerio) hox complex with description of a novel member, hox b 13a JOURNAL Evol Dev 7 (5), 362-375 (2005) PUBMED 16174031 REFERENCE 9 (bases 1 to 1821) AUTHORS Santini S and Bernardi G. TITLE Organization and base composition of tilapia Hox genes: implications for the evolution of Hox clusters in fish JOURNAL Gene 346, 51-61 (2005) PUBMED 15716008 REFERENCE 10 (bases 1 to 1821) AUTHORS Davidson AJ, Ernst P, Wang Y, Dekens MP, Kingsley PD, Palis J, Korsmeyer SJ, Daley GQ and Zon LI. TITLE cdx4 mutants fail to specify blood progenitors and can be rescued by multiple hox genes JOURNAL Nature 425 (6955), 300-306 (2003) PUBMED 13679919 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC053287.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC053287.1, CA474905.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA3505370, SAMEA3505371 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1821 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="3" /map="3" gene 1..1821 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="homeobox B8a" /db_xref="GeneID:30343" /db_xref="ZFIN:ZDB-GENE-990415-108" exon 1..801 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /inference="alignment:Splign:2.1.0" misc_feature 372..374 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="upstream in-frame stop codon" CDS 378..1115 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="hox-B8; homeobox gene B-8; homeo box B8a" /codon_start=1 /product="homeobox protein Hox-B8a" /protein_id="NP_571195.1" /db_xref="GeneID:30343" /db_xref="ZFIN:ZDB-GENE-990415-108" /translation="
MSSYFVNSLFTKYKSGDTLRPNYYECGFAQDLGTRPTVVYGPGTGATFQHAPQIQEFYHHGASTLSAAPYQQSPCAVTCHGEPGNFYGYDALQRQTLFGAQDADLVQYSDCKLATGGIGDETDNTEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKSEQEQIEKEKREKEQASGTQSAGEDCDKAKQM"
misc_feature 777..794 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="propagated from UniProtKB/Swiss-Prot (Q8AWZ0.1); Region: Antp-type hexapeptide" misc_feature order(813..827,831..833,882..884,900..902,939..941, 945..950,957..962,966..974,978..983) /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(819..821,828..830,948..950,957..962,969..971) /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 822..980 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature 981..1112 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /note="propagated from UniProtKB/Swiss-Prot (Q8AWZ0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 802..1811 /gene="hoxb8a" /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02; zgc:64159" /inference="alignment:Splign:2.1.0" ORIGIN
cgcagagcggtgtccgtgtggggatgcgagaaaccagtggaacgaggatcagacagaagatgcaaatgatcatcaaaacacaccgcaaaatatgaaactactcatttgcagccgagtaaatcatagaaaactgatcgggaactggcaccattcgccggaattgtgatgctggaactttacagtgggaacatgccaatggaagctttagataagttgttttaacaaaaggtatacacacgcaagccgcccagtaattggaaatcaacgctttgctgcaacattgttacctcagtaactgtgagctgctgcgcttatataaagacattctatcgtaatctcttgaacaaaatcagtaccaccaccaacagcagtaaaagatgagctcatatttcgtcaactctctcttcactaagtacaaaagtggagacactttacgaccaaactattacgagtgcggatttgctcaggacctagggacgagacccaccgtcgtgtatggtccaggcaccggggccactttccagcatgctcctcaaattcaggagttttaccaccacggcgcatccacgctctccgctgcgccttaccagcagagtccatgtgcggtaacctgtcacggcgagccgggtaacttctacggttatgatgctctccagaggcaaacacttttcggtgctcaagacgccgacttggttcagtatagcgactgcaagctcgccacggggggcatcggcgacgagacggacaacacagaacagagtccgtcgcccacacaactgttcccgtggatgcgacctcaagctgccggacggagacgaggccgtcagacctacagccgctatcagacgctcgaactggagaaagagtttctcttcaatccctacctaacacgcaagcgtcggattgaagtgtcacacgctttaggactgacagaacgacaagtcaaaatctggtttcaaaaccgtcgcatgaaatggaaaaaggaaaacaacaaggacaagtttccaagcagcaagtctgaacaagagcagatcgaaaaagaaaaacgggagaaagaacaggcatccggtacacagtcagccggcgaagactgcgacaaggcaaaacaaatgtagagcggatgcaagcgtgtgtgtatgtgtgtgtgagagtgtatgtgtgtgcgcgtgtgcgtgtgcgtgtgtgtgtgtgtgtgtgagtgaggcagtgtttgtgtgtgtcagtcaatcaaaattgcaaggaatatatagggaaaatcaaacagactatgatgaacagaataacggtgcttgcatgacaggcttgtctcatagagacattgtaatcaagtcgggtggttacatctttcactcgaggaaggaacagaaaaaatactgggacttgacgaatgaataattttaatgtgatgcccacagaacatcaggaagacgaaggacaagaagcatttctactttttacctgttgttcagagagtatgatagtgttaaagctagtctcctttctttgtggaataattatcgtgaaacttatgtttctattgttaggatattgtcattaacaattaccttggcagctgtatagtttttaagttaaatggtgcacttttaactgttctcacttatatgttatgatgacgtagaaattactgacttccaacaacatgaaactgcctatttatgccgtagaatctctttttacacgtctttggttcttcttaaatcgatggtatttttgttgtcttcctttcttggggtaagcatgcgcacagtgaattataaaaatgaataaacataataaaaaagtataaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]