GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-16 14:04:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_131120               1821 bp    mRNA    linear   VRT 30-SEP-2023
DEFINITION  Danio rerio homeobox B8a (hoxb8a), mRNA.
ACCESSION   NM_131120
VERSION     NM_131120.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1821)
  AUTHORS   Mukaigasa K, Sakuma C and Yaginuma H.
  TITLE     The developmental hourglass model is applicable to the spinal cord
            based on single-cell transcriptomes and non-conserved
            cis-regulatory elements
  JOURNAL   Dev Growth Differ 63 (7), 372-391 (2021)
   PUBMED   34473348
REFERENCE   2  (bases 1 to 1821)
  AUTHORS   Yamada K, Maeno A, Araki S, Kikuchi M, Suzuki M, Ishizaka M, Satoh
            K, Akama K, Kawabe Y, Suzuki K, Kobayashi D, Hamano N and Kawamura
            A.
  TITLE     An atlas of seven zebrafish hox cluster mutants provides insights
            into sub/neofunctionalization of vertebrate Hox clusters
  JOURNAL   Development 148 (11) (2021)
   PUBMED   34096572
REFERENCE   3  (bases 1 to 1821)
  AUTHORS   Lu CJ, Fan XY, Guo YF, Cheng ZC, Dong J, Chen JZ, Li LY, Wang MW,
            Wu ZK, Wang F, Tong XJ, Luo LF, Tang FC, Zhu ZY and Zhang B.
  TITLE     Single-cell analyses identify distinct and intermediate states of
            zebrafish pancreatic islet development
  JOURNAL   J Mol Cell Biol 11 (6), 435-447 (2019)
   PUBMED   30407522
REFERENCE   4  (bases 1 to 1821)
  AUTHORS   Lan Y, Pan H, Li C, Banks KM, Sam J, Ding B, Elemento O, Goll MG
            and Evans T.
  TITLE     TETs Regulate Proepicardial Cell Migration through Extracellular
            Matrix Organization during Zebrafish Cardiogenesis
  JOURNAL   Cell Rep 26 (3), 720-732 (2019)
   PUBMED   30650362
REFERENCE   5  (bases 1 to 1821)
  AUTHORS   Malmstrom M, Britz R, Matschiner M, Torresen OK, Hadiaty RK, Yaakob
            N, Tan HH, Jakobsen KS, Salzburger W and Ruber L.
  TITLE     The Most Developmentally Truncated Fishes Show Extensive Hox Gene
            Loss and Miniaturized Genomes
  JOURNAL   Genome Biol Evol 10 (4), 1088-1103 (2018)
   PUBMED   29684203
REFERENCE   6  (bases 1 to 1821)
  AUTHORS   Kurosawa G, Takamatsu N, Takahashi M, Sumitomo M, Sanaka E, Yamada
            K, Nishii K, Matsuda M, Asakawa S, Ishiguro H, Miura K, Kurosawa Y,
            Shimizu N, Kohara Y and Hori H.
  TITLE     Organization and structure of hox gene loci in medaka genome and
            comparison with those of pufferfish and zebrafish genomes
  JOURNAL   Gene 370, 75-82 (2006)
   PUBMED   16472944
  REMARK    Erratum:[Gene. 2006 Jul;376(2):298-9]
REFERENCE   7  (bases 1 to 1821)
  AUTHORS   Phillips RB, Amores A, Morasch MR, Wilson C and Postlethwait JH.
  TITLE     Assignment of zebrafish genetic linkage groups to chromosomes
  JOURNAL   Cytogenet Genome Res 114 (2), 155-162 (2006)
   PUBMED   16825768
REFERENCE   8  (bases 1 to 1821)
  AUTHORS   Corredor-Adamez M, Welten MC, Spaink HP, Jeffery JE, Schoon RT, de
            Bakker MA, Bagowski CP, Meijer AH, Verbeek FJ and Richardson MK.
  TITLE     Genomic annotation and transcriptome analysis of the zebrafish
            (Danio rerio) hox complex with description of a novel member, hox b
            13a
  JOURNAL   Evol Dev 7 (5), 362-375 (2005)
   PUBMED   16174031
REFERENCE   9  (bases 1 to 1821)
  AUTHORS   Santini S and Bernardi G.
  TITLE     Organization and base composition of tilapia Hox genes:
            implications for the evolution of Hox clusters in fish
  JOURNAL   Gene 346, 51-61 (2005)
   PUBMED   15716008
REFERENCE   10 (bases 1 to 1821)
  AUTHORS   Davidson AJ, Ernst P, Wang Y, Dekens MP, Kingsley PD, Palis J,
            Korsmeyer SJ, Daley GQ and Zon LI.
  TITLE     cdx4 mutants fail to specify blood progenitors and can be rescued
            by multiple hox genes
  JOURNAL   Nature 425 (6955), 300-306 (2003)
   PUBMED   13679919
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC053287.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC053287.1, CA474905.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA3505370, SAMEA3505371
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1821
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="3"
                     /map="3"
     gene            1..1821
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="homeobox B8a"
                     /db_xref="GeneID:30343"
                     /db_xref="ZFIN:ZDB-GENE-990415-108"
     exon            1..801
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    372..374
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="upstream in-frame stop codon"
     CDS             378..1115
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="hox-B8; homeobox gene B-8; homeo box B8a"
                     /codon_start=1
                     /product="homeobox protein Hox-B8a"
                     /protein_id="NP_571195.1"
                     /db_xref="GeneID:30343"
                     /db_xref="ZFIN:ZDB-GENE-990415-108"
                     /translation="
MSSYFVNSLFTKYKSGDTLRPNYYECGFAQDLGTRPTVVYGPGTGATFQHAPQIQEFYHHGASTLSAAPYQQSPCAVTCHGEPGNFYGYDALQRQTLFGAQDADLVQYSDCKLATGGIGDETDNTEQSPSPTQLFPWMRPQAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKSEQEQIEKEKREKEQASGTQSAGEDCDKAKQM"
     misc_feature    777..794
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8AWZ0.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(813..827,831..833,882..884,900..902,939..941,
                     945..950,957..962,966..974,978..983)
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(819..821,828..830,948..950,957..962,969..971)
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    822..980
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    981..1112
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8AWZ0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            802..1811
                     /gene="hoxb8a"
                     /gene_synonym="fj67g02; gp-8; hoxb8; wu:fj67g02;
                     zgc:64159"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cgcagagcggtgtccgtgtggggatgcgagaaaccagtggaacgaggatcagacagaagatgcaaatgatcatcaaaacacaccgcaaaatatgaaactactcatttgcagccgagtaaatcatagaaaactgatcgggaactggcaccattcgccggaattgtgatgctggaactttacagtgggaacatgccaatggaagctttagataagttgttttaacaaaaggtatacacacgcaagccgcccagtaattggaaatcaacgctttgctgcaacattgttacctcagtaactgtgagctgctgcgcttatataaagacattctatcgtaatctcttgaacaaaatcagtaccaccaccaacagcagtaaaagatgagctcatatttcgtcaactctctcttcactaagtacaaaagtggagacactttacgaccaaactattacgagtgcggatttgctcaggacctagggacgagacccaccgtcgtgtatggtccaggcaccggggccactttccagcatgctcctcaaattcaggagttttaccaccacggcgcatccacgctctccgctgcgccttaccagcagagtccatgtgcggtaacctgtcacggcgagccgggtaacttctacggttatgatgctctccagaggcaaacacttttcggtgctcaagacgccgacttggttcagtatagcgactgcaagctcgccacggggggcatcggcgacgagacggacaacacagaacagagtccgtcgcccacacaactgttcccgtggatgcgacctcaagctgccggacggagacgaggccgtcagacctacagccgctatcagacgctcgaactggagaaagagtttctcttcaatccctacctaacacgcaagcgtcggattgaagtgtcacacgctttaggactgacagaacgacaagtcaaaatctggtttcaaaaccgtcgcatgaaatggaaaaaggaaaacaacaaggacaagtttccaagcagcaagtctgaacaagagcagatcgaaaaagaaaaacgggagaaagaacaggcatccggtacacagtcagccggcgaagactgcgacaaggcaaaacaaatgtagagcggatgcaagcgtgtgtgtatgtgtgtgtgagagtgtatgtgtgtgcgcgtgtgcgtgtgcgtgtgtgtgtgtgtgtgtgagtgaggcagtgtttgtgtgtgtcagtcaatcaaaattgcaaggaatatatagggaaaatcaaacagactatgatgaacagaataacggtgcttgcatgacaggcttgtctcatagagacattgtaatcaagtcgggtggttacatctttcactcgaggaaggaacagaaaaaatactgggacttgacgaatgaataattttaatgtgatgcccacagaacatcaggaagacgaaggacaagaagcatttctactttttacctgttgttcagagagtatgatagtgttaaagctagtctcctttctttgtggaataattatcgtgaaacttatgtttctattgttaggatattgtcattaacaattaccttggcagctgtatagtttttaagttaaatggtgcacttttaactgttctcacttatatgttatgatgacgtagaaattactgacttccaacaacatgaaactgcctatttatgccgtagaatctctttttacacgtctttggttcttcttaaatcgatggtatttttgttgtcttcctttcttggggtaagcatgcgcacagtgaattataaaaatgaataaacataataaaaaagtataaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]