GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 19:01:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_202751               1297 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana double-stranded-RNA-binding protein 4 (DRB4),
            mRNA.
ACCESSION   NM_202751
VERSION     NM_202751.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1297)
  AUTHORS   Salanoubat,M., Lemcke,K., Rieger,M., Ansorge,W., Unseld,M.,
            Fartmann,B., Valle,G., Blocker,H., Perez-Alonso,M., Obermaier,B.,
            Delseny,M., Boutry,M., Grivell,L.A., Mache,R., Puigdomenech,P., De
            Simone,V., Choisne,N., Artiguenave,F., Robert,C., Brottier,P.,
            Wincker,P., Cattolico,L., Weissenbach,J., Saurin,W., Quetier,F.,
            Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Benes,V.,
            Wurmbach,E., Drzonek,H., Erfle,H., Jordan,N., Bangert,S.,
            Wiedelmann,R., Kranz,H., Voss,H., Holland,R., Brandt,P.,
            Nyakatura,G., Vezzi,A., D'Angelo,M., Pallavicini,A., Toppo,S.,
            Simionati,B., Conrad,A., Hornischer,K., Kauer,G., Lohnert,T.H.,
            Nordsiek,G., Reichelt,J., Scharfe,M., Schon,O., Bargues,M.,
            Terol,J., Climent,J., Navarro,P., Collado,C., Perez-Perez,A.,
            Ottenwalder,B., Duchemin,D., Cooke,R., Laudie,M., Berger-Llauro,C.,
            Purnelle,B., Masuy,D., de Haan,M., Maarse,A.C., Alcaraz,J.P.,
            Cottet,A., Casacuberta,E., Monfort,A., Argiriou,A., flores,M.,
            Liguori,R., Vitale,D., Mannhaupt,G., Haase,D., Schoof,H., Rudd,S.,
            Zaccaria,P., Mewes,H.W., Mayer,K.F., Kaul,S., Town,C.D., Koo,H.L.,
            Tallon,L.J., Jenkins,J., Rooney,T., Rizzo,M., Walts,A.,
            Utterback,T., Fujii,C.Y., Shea,T.P., Creasy,T.H., Haas,B.,
            Maiti,R., Wu,D., Peterson,J., Van Aken,S., Pai,G., Militscher,J.,
            Sellers,P., Gill,J.E., Feldblyum,T.V., Preuss,D., Lin,X.,
            Nierman,W.C., Salzberg,S.L., White,O., Venter,J.C., Fraser,C.M.,
            Kaneko,T., Nakamura,Y., Sato,S., Kato,T., Asamizu,E., Sasamoto,S.,
            Kimura,T., Idesawa,K., Kawashima,K., Kishida,Y., Kiyokawa,C.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A.,
            Yamada,M., Yasuda,M. and Tabata,S.
  CONSRTM   European Union Chromosome 3 Arabidopsis Sequencing Consortium;
            Institute for Genomic Research; Kazusa DNA Research Institute
  TITLE     Sequence and analysis of chromosome 3 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 820-822 (2000)
   PUBMED   11130713
REFERENCE   2  (bases 1 to 1297)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1297)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1297)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003074).
FEATURES             Location/Qualifiers
     source          1..1297
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="3"
                     /ecotype="Columbia"
     gene            1..1297
                     /gene="DRB4"
                     /locus_tag="AT3G62800"
                     /gene_synonym="ATTIF3K1; double-stranded-RNA-binding
                     protein 4"
                     /note="Encodes a nuclear dsRNA-binding protein DRB4 that
                     interacts specifically with DCL4. May regulate DCL4
                     function and thereby affect miRNA biogenesis. Also has an
                     impact on polymerase IV-dependent siRNA levels. DRB4
                     interacts with the P6 viral protein from Cauliflower
                     mosaic virus and may be a target of viral silencing
                     suppression."
                     /db_xref="Araport:AT3G62800"
                     /db_xref="GeneID:825455"
                     /db_xref="TAIR:AT3G62800"
     CDS             73..1140
                     /gene="DRB4"
                     /locus_tag="AT3G62800"
                     /gene_synonym="ATTIF3K1; double-stranded-RNA-binding
                     protein 4"
                     /inference="Similar to RNA sequence,
                     EST:INSD:AV789028.1,INSD:EG490615.1,INSD:EL317902.1,
                     INSD:EL298579.1,INSD:EL986072.1,INSD:EH831297.1,
                     INSD:EL001686.1,INSD:EH975965.1,INSD:EH816638.1,
                     INSD:EG519674.1,INSD:EL987543.1"
                     /inference="Similar to RNA sequence,
                     mRNA:INSD:BX823891.1,INSD:AY150509.1"
                     /note="double-stranded-RNA-binding protein 4 (DRB4);
                     FUNCTIONS IN: double-stranded RNA binding, protein
                     binding; INVOLVED IN: production of ta-siRNAs involved in
                     RNA interference; LOCATED IN: nucleus; EXPRESSED IN: 25
                     plant structures; EXPRESSED DURING: 15 growth stages;
                     CONTAINS InterPro DOMAIN/s: Double-stranded RNA-binding
                     (InterPro:IPR001159), Double-stranded RNA-binding-like
                     (InterPro:IPR014720); BEST Arabidopsis thaliana protein
                     match is: dsRNA-binding protein 3 (TAIR:AT3G26932.2); Has
                     35333 Blast hits to 34131 proteins in 2444 species: Archae
                     - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991;
                     Plants - 531; Viruses - 0; Other Eukaryotes - 9610
                     (source: NCBI BLink)."
                     /codon_start=1
                     /product="double-stranded-RNA-binding protein 4"
                     /protein_id="NP_974480.1"
                     /db_xref="GeneID:825455"
                     /db_xref="TAIR:AT3G62800"
                     /db_xref="Araport:AT3G62800"
                     /translation="
MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLTPQSPEGIDVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNGNSNQTGSPTLPSERQEDVNSNVKSSPQEIHSQPSSKVVMTPDTPSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGTLSALTTDGMKMNIASSSLPIPHNPTNVITLNAPAANGIKRNIAACSSWMPQNPTNDGSETSSCVVDESEKKKLIMGTGHLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAYRLVKP"
     misc_feature    82..288
                     /gene="DRB4"
                     /locus_tag="AT3G62800"
                     /gene_synonym="ATTIF3K1; double-stranded-RNA-binding
                     protein 4"
                     /note="first double-stranded RNA binding motif of
                     Arabidopsis thaliana double-stranded RNA-binding proteins
                     (AtDRBs)and similar proteins; Region:
                     DSRM_AtDRB-like_rpt1; cd19907"
                     /db_xref="CDD:380736"
     misc_feature    order(94..96,100..105,112..117,130..135,160..174,178..180,
                     232..243,250..255)
                     /gene="DRB4"
                     /locus_tag="AT3G62800"
                     /gene_synonym="ATTIF3K1; double-stranded-RNA-binding
                     protein 4"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:380736"
     misc_feature    313..519
                     /gene="DRB4"
                     /locus_tag="AT3G62800"
                     /gene_synonym="ATTIF3K1; double-stranded-RNA-binding
                     protein 4"
                     /note="second double-stranded RNA binding motif of
                     Arabidopsis thaliana double-stranded RNA-binding proteins
                     (AtDRBs)and similar proteins; Region:
                     DSRM_AtDRB-like_rpt2; cd19908"
                     /db_xref="CDD:380737"
     misc_feature    order(328..330,334..339,346..351,364..369,394..408,
                     412..414,463..474,481..486)
                     /gene="DRB4"
                     /locus_tag="AT3G62800"
                     /gene_synonym="ATTIF3K1; double-stranded-RNA-binding
                     protein 4"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:380737"
ORIGIN      
caatcagcgaatgctttgtctgattgttcacttcctccctcgaagtgtcttcaccatttcaaagagatagagatggatcatgtatacaaaggtcaactgcaagcgtatgccctgcaacataatctggagctaccagtgtatgcgaatgagagagaagggcctcctcatgctcctagatttagatgtaatgttacattctgtggacagactttccagagctctgaattctttccgacactaaaatcggctgaacatgccgctgcaaaaattgcagttgcttctttgacgccacaaagtccagagggaattgatgttgcctacaagaacctgttacaagaaattgcacagaaagagagttctctgttaccattttatgcaactgctacatctggtccatcgcatgcgcctacttttacttcaactgttgagtttgctggtaaagttttcagtggagaagaggcgaaaaccaaaaagttggctgaaatgagcgctgctaaagttgcattcatgagtatcaaaaatgggaactcgaaccagaccggatcgcctactttgcctagtgagagacaagaagatgtaaattcaaatgtgaagagcagtccacaagagatccattctcaaccttcttccaaggtggtgatgacccctgataccccatcaaaggggattaaagtgaatgaagatgaatttccagatcttcatgatgcaccagccagtaatgctaaggagattaacgttgctttgaatgagcctgagaatcctacaaacgatggtactcttagtgcactaactactgatggtatgaagatgaacattgcttcttcttctttgcctatacctcacaatcctacaaacgttattactcttaatgcaccagctgccaatggtatcaagaggaacattgctgcttgttcttcgtggatgcctcagaatcccacaaacgatggtagtgaaacatcatcatgtgtagtagatgagagtgagaaaaagaagctcataatgggaactggccacctgagtataccaactggccaacatgtagtttgtcgcccatggaaccccgagataactcttcctcaagacgcggagatgctctttagagatgataaatttatagcctatcgtcttgtgaagccataacgacatcatcatctttgatgcataataagtgtagagatagaatgttaaggtaagctatatctcatctgtttgtagaaatagaatgcttctcgtctctggttttcttaagcaatatgctatgtagtatgtatactgtgtaatgactaatttttgtttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]