2024-05-20 03:54:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_061310036 428 bp mRNA linear INV 07-DEC-2023 DEFINITION PREDICTED: Saccostrea echinata uncharacterized LOC133174943 (LOC133174943), mRNA. ACCESSION XM_061310036 VERSION XM_061310036.1 DBLINK BioProject: PRJNA1046542 KEYWORDS RefSeq; includes ab initio. SOURCE Saccostrea echinata ORGANISM Saccostrea echinata Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia; Autobranchia; Pteriomorphia; Ostreida; Ostreoidea; Ostreidae; Saccostrea. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026889809) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_033153115.1-RS_2023_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/02/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 10% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..428 /organism="Saccostrea echinata" /mol_type="mRNA" /isolate="AGI-Se365-2" /db_xref="taxon:191078" /chromosome="Unknown" /tissue_type="muscle" /ecotype="Australia" /country="Australia" /collection_date="2022" gene 1..428 /gene="LOC133174943" /note="uncharacterized LOC133174943; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:133174943" CDS 45..428 /gene="LOC133174943" /codon_start=1 /product="uncharacterized protein LOC133174943" /protein_id="XP_061166020.1" /db_xref="GeneID:133174943" /translation="
MAIRAIQEEMMFSGQTLGCRSMKRRLLQKHGIFIGRDNMLCLLRIIDPDGVDLRASHCLTRRMYLNNGPNYLAHVDGYDKLKPFGFAIHGAMCGFSRRILWLKVARTNNDSFVVASYFLKYLEEINS"
ORIGIN
taaccagacttaacttgagaagacggagatcatacaatgtgaatatggcaataagggctattcaggaagaaatgatgttcagtggacagactcttgggtgtcgttcgatgaaacgaagacttcttcagaaacatggcatctttataggaagggataacatgttgtgtttattgagaataatcgatcctgatggagttgatctaagagcaagtcactgcttgacaagaagaatgtatctaaacaatggaccaaattatcttgcacatgttgatgggtacgacaagttgaagccatttggcttcgctatacatggtgcaatgtgtggattttcaagacgaatactatggcttaaagttgcaagaacaaacaatgactcctttgttgtagcatcatatttcttgaaatacctggaggaaataaatagttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]