2024-05-19 05:23:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_060628074 1113 bp mRNA linear MAM 01-NOV-2023 DEFINITION PREDICTED: Panthera onca copper-transporting ATPase 1-like (LOC132675846), mRNA. ACCESSION XM_060628074 VERSION XM_060628074.1 DBLINK BioProject: PRJNA1028623 KEYWORDS RefSeq. SOURCE Panthera onca (jaguar) ORGANISM Panthera onca Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae; Pantherinae; Panthera. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026823258) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_028533385.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/19/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1113 /organism="Panthera onca" /mol_type="mRNA" /isolate="Sample0147" /db_xref="taxon:9690" /chromosome="Unknown" /sex="female" /tissue_type="blood: Jugular" /collection_date="2015-07-29" /collected_by="Julia Jones, Liz McCrae" gene 1..1113 /gene="LOC132675846" /note="copper-transporting ATPase 1-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:132675846" CDS 546..1010 /gene="LOC132675846" /codon_start=1 /product="copper-transporting ATPase 1-like" /protein_id="XP_060484057.1" /db_xref="GeneID:132675846" /translation="
MKRIFPCLPDTNEPLVIIAQTSSEMPLLTSTNEFYTKTMTPIHDGEVKPSSKCYIQVTGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPPVIAEFIRELGFGATMIENADEGDGVLELVVSNHFCVINKISRKNSGGRFRK"
ORIGIN
tattagtgtttaaaattcaaacaatacagaagtgtctgtagagaaaatgtgtttgtttgtcattcttttcctgccttaaccccattccccagaagtagccaccattaatgttttggaacgtagcctcccagattttcttatgcctagtctcatatacacatatacacaaaaactttttaaatgacatcataccgcaatgctgttttgtaaattgcttttttgttccacttactgtatcatgaattgctttaatgtagtatacaaatcattaacatggtgataaaaattccttataaaaataagagctgcccattaacaactactctttatctggggttttcagtagagaaaacagctagaagaacttggtataaccaaagttttgtttattcagttagttccgatccaaagaactgggatgggcagtatttgaagtcacttcctagaaagtgtaaagtccatgctggttttaaacgaatggattgacagtacctggaggtgtggattgtgatgaatgacaaggatgcaactaaagaatatcttaaatgaaaagaatctttccctgtctaccagatacaaatgagccattggtaataatagctcagacctcatcagaaatgccgcttttgacctcaactaatgaattttatactaaaacgatgacaccaattcacgatggggaagtaaagccttcgtctaagtgttatatacaggtcactggtatgacttgtgcttcctgtgtagcaaacattgaacggaatttaagacgagaagaaggaatatattctgtacttgtggctctgatggctggcaaagcagaagtaagatataatcctgctgttatacaacccccagtgatagctgagttcatccgagagcttggatttggagccactatgatagaaaatgctgatgaaggagatggtgttttggaacttgttgtaagtaatcatttttgtgtaattaataaaatttccaggaaaaactcggggggaagattcagaaaatagttccaaagttatttaagggttgggaaaataaagcataaaaggaaaattaaggaaactggaaaatagaaggataagatacgacttaatggtggcctttaagcct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]