GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 05:23:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_060628074            1113 bp    mRNA    linear   MAM 01-NOV-2023
DEFINITION  PREDICTED: Panthera onca copper-transporting ATPase 1-like
            (LOC132675846), mRNA.
ACCESSION   XM_060628074
VERSION     XM_060628074.1
DBLINK      BioProject: PRJNA1028623
KEYWORDS    RefSeq.
SOURCE      Panthera onca (jaguar)
  ORGANISM  Panthera onca
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;
            Pantherinae; Panthera.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026823258) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_028533385.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/19/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1113
                     /organism="Panthera onca"
                     /mol_type="mRNA"
                     /isolate="Sample0147"
                     /db_xref="taxon:9690"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="blood: Jugular"
                     /collection_date="2015-07-29"
                     /collected_by="Julia Jones, Liz McCrae"
     gene            1..1113
                     /gene="LOC132675846"
                     /note="copper-transporting ATPase 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:132675846"
     CDS             546..1010
                     /gene="LOC132675846"
                     /codon_start=1
                     /product="copper-transporting ATPase 1-like"
                     /protein_id="XP_060484057.1"
                     /db_xref="GeneID:132675846"
                     /translation="
MKRIFPCLPDTNEPLVIIAQTSSEMPLLTSTNEFYTKTMTPIHDGEVKPSSKCYIQVTGMTCASCVANIERNLRREEGIYSVLVALMAGKAEVRYNPAVIQPPVIAEFIRELGFGATMIENADEGDGVLELVVSNHFCVINKISRKNSGGRFRK"
ORIGIN      
tattagtgtttaaaattcaaacaatacagaagtgtctgtagagaaaatgtgtttgtttgtcattcttttcctgccttaaccccattccccagaagtagccaccattaatgttttggaacgtagcctcccagattttcttatgcctagtctcatatacacatatacacaaaaactttttaaatgacatcataccgcaatgctgttttgtaaattgcttttttgttccacttactgtatcatgaattgctttaatgtagtatacaaatcattaacatggtgataaaaattccttataaaaataagagctgcccattaacaactactctttatctggggttttcagtagagaaaacagctagaagaacttggtataaccaaagttttgtttattcagttagttccgatccaaagaactgggatgggcagtatttgaagtcacttcctagaaagtgtaaagtccatgctggttttaaacgaatggattgacagtacctggaggtgtggattgtgatgaatgacaaggatgcaactaaagaatatcttaaatgaaaagaatctttccctgtctaccagatacaaatgagccattggtaataatagctcagacctcatcagaaatgccgcttttgacctcaactaatgaattttatactaaaacgatgacaccaattcacgatggggaagtaaagccttcgtctaagtgttatatacaggtcactggtatgacttgtgcttcctgtgtagcaaacattgaacggaatttaagacgagaagaaggaatatattctgtacttgtggctctgatggctggcaaagcagaagtaagatataatcctgctgttatacaacccccagtgatagctgagttcatccgagagcttggatttggagccactatgatagaaaatgctgatgaaggagatggtgttttggaacttgttgtaagtaatcatttttgtgtaattaataaaatttccaggaaaaactcggggggaagattcagaaaatagttccaaagttatttaagggttgggaaaataaagcataaaaggaaaattaaggaaactggaaaatagaaggataagatacgacttaatggtggcctttaagcct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]