LOCUS       XM_058920720             321 bp    mRNA    linear   PLN 16-AUG-2023
DEFINITION  PREDICTED: Vicia villosa protein CLAVATA 3-like (LOC131651040),
            mRNA.
ACCESSION   XM_058920720
VERSION     XM_058920720.1
DBLINK      BioProject: PRJNA1001345
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Vicia villosa (hairy vetch)
  ORGANISM  Vicia villosa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; Hologalegina; IRL clade; Fabeae;
            Vicia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081181) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_029867415.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/08/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..321
                     /organism="Vicia villosa"
                     /mol_type="mRNA"
                     /cultivar="HV-30"
                     /db_xref="taxon:3911"
                     /tissue_type="leaf"
                     /dev_stage="mature"
                     /ecotype="Madison, WI"
                     /country="USA: Wisconsin"
                     /linkage_group="LG2"
     gene            1..321
                     /gene="LOC131651040"
                     /note="protein CLAVATA 3-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:131651040"
     CDS             1..321
                     /gene="LOC131651040"
                     /codon_start=1
                     /product="protein CLAVATA 3-like"
                     /protein_id="XP_058776703.1"
                     /db_xref="GeneID:131651040"
                     /translation="

MASKFIPASVFLLVLFFLLLMRETSGCNSACACFDANGGGLKLSHNRKMLSSLKVKKAMLKVSVEGSSARMKKSEKEVIGEMRKVPTGPDPLHHHSIGNPIKPQTP"

ORIGIN      

atggcttcaaaattcattcctgcttctgtctttttacttgttcttttcttcttgcttctcatgagggagacttctggttgtaattctgcatgtgcatgctttgatgctaatggaggaggtcttaaacttagtcataacaggaagatgctgtctagtttgaaggttaagaaagctatgttgaaggttagtgttgaaggatcttcagcaaggatgaagaaaagtgagaaggaagtgattggagagatgagaaaggttcctacaggtccagatccacttcatcaccatagcattggcaatcctattaagcctcaaactccttaa

//