2024-05-19 07:34:04, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_058236510 432 bp mRNA linear PLN 19-JUL-2023 DEFINITION PREDICTED: Magnolia sinica plasma membrane ATPase 2-like (LOC131238927), mRNA. ACCESSION XM_058236510 VERSION XM_058236510.1 DBLINK BioProject: PRJNA994101 KEYWORDS RefSeq; includes ab initio. SOURCE Magnolia sinica ORGANISM Magnolia sinica Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Magnoliidae; Magnoliales; Magnoliaceae; Magnolia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_080575) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_029962835.1-RS_2023_07 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 07/13/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..432 /organism="Magnolia sinica" /mol_type="mRNA" /isolate="HGM2019" /db_xref="taxon:86752" /chromosome="3" /tissue_type="leaf" /country="China: Yunnan, Kunming" gene 1..432 /gene="LOC131238927" /note="plasma membrane ATPase 2-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:131238927" CDS 1..432 /gene="LOC131238927" /codon_start=1 /product="plasma membrane ATPase 2-like" /protein_id="XP_058092493.1" /db_xref="GeneID:131238927" /translation="
METIAGDQLAIAKETEHWLGMGTNLYPSSSLLGDNKDELVSALPVDELIEKADGFARVLPGDGVNDAPALKKANIGIAMADATDAARSASDIVLIEPGLSIGILHVPLTCSTFEFTYHDMDLFPGSIMTISKDRVKPSQLETQ"
misc_feature <10..420 /gene="LOC131238927" /note="plasma-membrane proton-efflux P-type ATPase; Region: ATPase-IIIA_H; TIGR01647" /db_xref="CDD:273731" ORIGIN
atggaaaccattgcaggtgatcaattggcaattgctaaggaaaccgagcattggttgggaatgggtacaaacttgtacccatcttcatctcttctgggggacaacaaggatgaattagtttcggctctacctgtggatgaactaattgagaaagctgatggttttgctagggtgcttcctggtgatggggtcaatgatgcacctgcattaaagaaagcaaacataggaattgcaatggcagatgcaacagatgctgctcgaagtgcttctgacatagttctaatagagcctggattgagtatagggattttgcatgtgccactgacctgttccacttttgaatttacgtaccatgacatggatctatttccaggtagtatcatgacaatctccaaggacagagtcaagccttctcagctggaaactcagtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]