2024-05-16 15:12:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_057598187 315 bp mRNA linear PLN 27-JUN-2023 DEFINITION PREDICTED: Lotus japonicus protein CLAVATA 3 (LOC130745802), mRNA. ACCESSION XM_057598187 VERSION XM_057598187.1 DBLINK BioProject: PRJNA984304 KEYWORDS RefSeq. SOURCE Lotus japonicus ORGANISM Lotus japonicus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; Hologalegina; robinioid clade; Loteae; Lotus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_080043) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_012489685.1-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/21/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..315 /organism="Lotus japonicus" /mol_type="mRNA" /db_xref="taxon:34305" /chromosome="3" /ecotype="B-129" gene 1..315 /gene="LOC130745802" /note="protein CLAVATA 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:130745802" CDS 1..315 /gene="LOC130745802" /codon_start=1 /product="protein CLAVATA 3" /protein_id="XP_057454170.1" /db_xref="GeneID:130745802" /translation="
MASKSIVTIVILLLLFMCLSLIMRDPSDCNAAYGCSAASTKKILNRKVLSVLKDKKTTLKARVLQGSPNSKYIAEKSLSWQLRKVPSGPDPLHHHGGSPKPETP"
ORIGIN
atggcatcaaaatcgattgttaccattgtcattttgctgttgcttttcatgtgtttgagtctgatcatgagggacccttctgattgcaatgctgcctatggttgctcagcagctagtaccaagaagattctgaacagaaaggtgctctctgttttgaaggacaagaagacaactttgaaggctagggtactgcaaggatcaccaaatagcaagtatattgctgaaaaatctctgagttggcagttgaggaaggttccttcaggtccagaccctctgcatcatcatggtggaagccccaagcctgaaaccccttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]