GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-16 15:12:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_057598187             315 bp    mRNA    linear   PLN 27-JUN-2023
DEFINITION  PREDICTED: Lotus japonicus protein CLAVATA 3 (LOC130745802), mRNA.
ACCESSION   XM_057598187
VERSION     XM_057598187.1
DBLINK      BioProject: PRJNA984304
KEYWORDS    RefSeq.
SOURCE      Lotus japonicus
  ORGANISM  Lotus japonicus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; Hologalegina; robinioid clade;
            Loteae; Lotus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_080043) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_012489685.1-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/21/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..315
                     /organism="Lotus japonicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:34305"
                     /chromosome="3"
                     /ecotype="B-129"
     gene            1..315
                     /gene="LOC130745802"
                     /note="protein CLAVATA 3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:130745802"
     CDS             1..315
                     /gene="LOC130745802"
                     /codon_start=1
                     /product="protein CLAVATA 3"
                     /protein_id="XP_057454170.1"
                     /db_xref="GeneID:130745802"
                     /translation="
MASKSIVTIVILLLLFMCLSLIMRDPSDCNAAYGCSAASTKKILNRKVLSVLKDKKTTLKARVLQGSPNSKYIAEKSLSWQLRKVPSGPDPLHHHGGSPKPETP"
ORIGIN      
atggcatcaaaatcgattgttaccattgtcattttgctgttgcttttcatgtgtttgagtctgatcatgagggacccttctgattgcaatgctgcctatggttgctcagcagctagtaccaagaagattctgaacagaaaggtgctctctgttttgaaggacaagaagacaactttgaaggctagggtactgcaaggatcaccaaatagcaagtatattgctgaaaaatctctgagttggcagttgaggaaggttccttcaggtccagaccctctgcatcatcatggtggaagccccaagcctgaaaccccttag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]