2024-05-18 12:50:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_056995554 403 bp mRNA linear PLN 08-JUN-2023 DEFINITION PREDICTED: Raphanus sativus protein GOLVEN 11-like (LOC130500629), mRNA. ACCESSION XM_056995554 VERSION XM_056995554.1 DBLINK BioProject: PRJNA344915 KEYWORDS RefSeq. SOURCE Raphanus sativus (radish) ORGANISM Raphanus sativus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_026615330) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000801105.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/01/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..403 /organism="Raphanus sativus" /mol_type="mRNA" /cultivar="WK10039" /db_xref="taxon:3726" /chromosome="Unknown" /tissue_type="leaf" gene 1..403 /gene="LOC130500629" /note="protein GOLVEN 11-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:130500629" CDS 53..403 /gene="LOC130500629" /codon_start=1 /product="protein GOLVEN 11-like" /protein_id="XP_056851534.1" /db_xref="GeneID:130500629" /translation="
MVSMRALCYLLVFFILQLHAEVSHANFGRQVPQAAKNGGLGASTSTQTASKAIENVIGNRKALKYGNMKGEANEINSLAIESKETVRKRKSKKRLTKTVSLTADYSDPGHHPPRHN"
ORIGIN
cacacaaacaaacatacattaagccaacggaaagaaggaaaagaaacacgaaatggtgtccatgagggccctttgctatcttctagtatttttcatcttgcaattacatgctgaagtctcccatgcaaactttggtagacaagttccacaagcggcgaagaatggtgggcttggagcaagcactagtactcagactgccagcaaggctattgaaaatgtaatcggaaaccgaaaggcgttgaagtatggaaatatgaagggcgaggcaaatgaaattaacagtttggcgatagagagtaaagaaacggtaaggaaaagaaagagcaagaagaggctcaccaaaacggtgagtttaacggccgattacagcgaccctggtcatcatcctcctaggcataactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]