GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 12:50:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_056995554             403 bp    mRNA    linear   PLN 08-JUN-2023
DEFINITION  PREDICTED: Raphanus sativus protein GOLVEN 11-like (LOC130500629),
            mRNA.
ACCESSION   XM_056995554
VERSION     XM_056995554.1
DBLINK      BioProject: PRJNA344915
KEYWORDS    RefSeq.
SOURCE      Raphanus sativus (radish)
  ORGANISM  Raphanus sativus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Brassiceae; Raphanus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026615330) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_000801105.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/01/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..403
                     /organism="Raphanus sativus"
                     /mol_type="mRNA"
                     /cultivar="WK10039"
                     /db_xref="taxon:3726"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
     gene            1..403
                     /gene="LOC130500629"
                     /note="protein GOLVEN 11-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:130500629"
     CDS             53..403
                     /gene="LOC130500629"
                     /codon_start=1
                     /product="protein GOLVEN 11-like"
                     /protein_id="XP_056851534.1"
                     /db_xref="GeneID:130500629"
                     /translation="
MVSMRALCYLLVFFILQLHAEVSHANFGRQVPQAAKNGGLGASTSTQTASKAIENVIGNRKALKYGNMKGEANEINSLAIESKETVRKRKSKKRLTKTVSLTADYSDPGHHPPRHN"
ORIGIN      
cacacaaacaaacatacattaagccaacggaaagaaggaaaagaaacacgaaatggtgtccatgagggccctttgctatcttctagtatttttcatcttgcaattacatgctgaagtctcccatgcaaactttggtagacaagttccacaagcggcgaagaatggtgggcttggagcaagcactagtactcagactgccagcaaggctattgaaaatgtaatcggaaaccgaaaggcgttgaagtatggaaatatgaagggcgaggcaaatgaaattaacagtttggcgatagagagtaaagaaacggtaaggaaaagaaagagcaagaagaggctcaccaaaacggtgagtttaacggccgattacagcgaccctggtcatcatcctcctaggcataactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]