2024-05-20 04:38:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_056543244 585 bp mRNA linear VRT 30-MAY-2023 DEFINITION PREDICTED: Hyla sarda hepcidin-like (LOC130293938), mRNA. ACCESSION XM_056543244 VERSION XM_056543244.1 DBLINK BioProject: PRJNA973623 KEYWORDS RefSeq. SOURCE Hyla sarda ORGANISM Hyla sarda Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Hylidae; Hylinae; Hylini; Hyla. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_079198) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_029499605.1-RS_2023_05 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 05/23/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..585 /organism="Hyla sarda" /mol_type="mRNA" /isolate="aHylSar1" /db_xref="taxon:327740" /chromosome="10" /sex="female" /tissue_type="muscle" /dev_stage="adult" /country="France: Corsica, Ghisonaccia" /lat_lon="42.050000 N 9.416667 E" /collection_date="2019-01-06" /collected_by="Daniele Canestrelli" gene 1..585 /gene="LOC130293938" /note="hepcidin-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:130293938" CDS 83..328 /gene="LOC130293938" /codon_start=1 /product="hepcidin-like" /protein_id="XP_056399219.1" /db_xref="GeneID:130293938" /translation="
MKSLSLCLILVLSLTVHRGLCASARRHNEVADPADHLASPDVVESHLEEVFHRTKRFSHLSICRFCCNCCKNKECGLCCKT"
ORIGIN
ccagcagggggtgctataaggtggagcagcgtcagatcccgacctcacctgctgatcactcatcgtctgatccagagagaagatgaagtccctcagcctctgcctcatcctcgtcctgtccctgaccgtccaccgggggctctgcgcctccgctagaaggcacaatgaggtagcagatcctgcagatcatctcgccagcccagacgtggtagagtcacatctagaggaggttttccatagaacaaagcgtttctcccacctttccatctgtcgcttctgctgcaattgttgcaagaacaaagagtgcggattatgttgcaagacctaagacccggagctccaccacagaatggagagacttgatctaagaacgcttgagattgagggccggtcaggagacaagatgtcttggggccccacagtggaagccccacagcccttcaccaggtggtgggggagggggtcttctttaattccgtatttctaagaatattcggagaaatgtccattgtcgctcatcgtgatgtaactgtatggagtctccagccctgtatttataagtgttgtcgatgtttttggtttata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]