GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 17:22:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_055946400             539 bp    mRNA    linear   PLN 08-MAY-2023
DEFINITION  PREDICTED: Solanum dulcamara uncharacterized LOC129871480
            (LOC129871480), mRNA.
ACCESSION   XM_055946400
VERSION     XM_055946400.1
DBLINK      BioProject: PRJNA967367
KEYWORDS    RefSeq.
SOURCE      Solanum dulcamara
  ORGANISM  Solanum dulcamara
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_077246) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_947179165.1-RS_2023_05
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 05/05/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..539
                     /organism="Solanum dulcamara"
                     /mol_type="mRNA"
                     /db_xref="taxon:45834"
                     /chromosome="10"
     gene            1..539
                     /gene="LOC129871480"
                     /note="uncharacterized LOC129871480; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:129871480"
     CDS             41..352
                     /gene="LOC129871480"
                     /codon_start=1
                     /product="uncharacterized protein LOC129871480"
                     /protein_id="XP_055802375.1"
                     /db_xref="GeneID:129871480"
                     /translation="
MMLPTRILSLLLLLILIAQILPNTTSYQCGKIATKRCNSAPKRESLANTGEEHEAVVIRGNKRKGEQILSRRPLSQSGGKGSAEFVAFTADYKSPRHHPPRHN"
ORIGIN      
cacagacataccccttccaaaaaattaagttcacgacaacatgatgctacctactaggattttaagcttattactactcctaatcttaattgctcaaattctgccaaacacgacttcttaccaatgtggcaaaattgcaaccaaaagatgcaattcagcaccaaagagagagtccttggcaaatactggtgaagaacatgaagcagttgtgataagaggaaacaaacgaaaaggtgaacaaattctgagcagacgtccactctcgcagtctgggggcaaaggtagtgctgaatttgttgcatttacagcagattataaatcaccaaggcatcatccaccaaggcacaactgataactttactagaatatcactaattttcgacggaccttcttttgatacatcaataaggatttttgatgtaaaaaaatcatcaaaaatattaccgacgagtcaaatttcgatcaatttcatcagaaattagtgatttttagtgcaatgcgaagtaccaattgaagatctatagtttaactacttttgc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]