GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 11:22:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_055580729            1054 bp    mRNA    linear   MAM 25-APR-2023
DEFINITION  PREDICTED: Bubalus carabanensis copper chaperone for superoxide
            dismutase (CCS), transcript variant X4, mRNA.
ACCESSION   XM_055580729
VERSION     XM_055580729.1
DBLINK      BioProject: PRJNA956113
KEYWORDS    RefSeq.
SOURCE      Bubalus carabanensis (carabao)
  ORGANISM  Bubalus carabanensis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia;
            Pecora; Bovidae; Bovinae; Bubalus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_073628) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_029407905.1-RS_2023_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/20/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1054
                     /organism="Bubalus carabanensis"
                     /mol_type="mRNA"
                     /isolate="K-KA32"
                     /db_xref="taxon:346063"
                     /chromosome="5"
                     /sex="female"
                     /tissue_type="blood"
                     /dev_stage="heifer"
                     /ecotype="Philippines"
                     /collection_date="2021-10-28"
                     /collected_by="Philippine Carabao Center"
                     /breed="swamp buffalo"
     gene            1..1054
                     /gene="CCS"
                     /note="copper chaperone for superoxide dismutase; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:129652284"
     CDS             138..884
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X4"
                     /protein_id="XP_055436704.1"
                     /db_xref="GeneID:129652284"
                     /translation="
MASDSEDRGTACTLEFAVQMTCQSCVDAVRTSLQGIAGIQSVEVQLENQMVLVQTTLPSQEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILGGPGPVQGVVRFLQLTPERCLIEGTIDGLQPGLHGLHVHQFGDLTRNCNSCGDHFNPDGMSHGGPQDSERVWDVIGRSLVVDEGEDDLGRGGHPLSRITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGQGRKEPAQPPAHL"
     polyA_site      1054
                     /gene="CCS"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
aaggagcagagccttgcgtgcgcgcgcagcggaaggcggggcaaggagtggcttccggggttccgcctccccctccccgcggcgcggctctgggctggcacttcagttccggccctcgggcgatagctggatccaggatggcttcggactcggaggaccgcgggactgcctgcacgctggagttcgcggtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggaatcgcaggcatccaaagtgtggaggtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagccaggaggtgcaggcccttctagaaggcactgggaggcaggcggtcctcaagggcatgggcagtggcctgttgcagaatttaggggcagccgtggccattctcggggggcctggccctgtgcagggagtggtgcgcttcctgcagctgacccctgagcgctgcctaatcgaggggaccattgatggcctgcagcctgggctgcatggactccacgtccatcagttcggggacctcacgaggaactgcaacagctgtggggaccactttaaccctgatggaatgtcccatgggggcccccaggactctgaacgggtgtgggatgtgattggccgaagcctggtcgtcgatgagggagaagatgacctgggccggggcgggcatcccttgtccaggatcacagggaactcaggagagaggttggcctgtggcatcatcgcacgctctgctggcctcttccagaaccccaagcagatctgctcctgtgatggcctcaccatctgggaggagcggggccggcccatcgctggccagggacggaaggagcctgcccagccccctgcccacctctgagcacggcctctgcctcgggtctgtcaccgtcctccctgctgagcaccgtccacttccagagggaggccctgctcacccagtcctgggagaaccagtgtgcaggctatgtttgatctcaaagggttgcttgctcttcccttggcaaattaaagttttattttcacatggaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]