2024-05-19 11:22:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_055580729 1054 bp mRNA linear MAM 25-APR-2023 DEFINITION PREDICTED: Bubalus carabanensis copper chaperone for superoxide dismutase (CCS), transcript variant X4, mRNA. ACCESSION XM_055580729 VERSION XM_055580729.1 DBLINK BioProject: PRJNA956113 KEYWORDS RefSeq. SOURCE Bubalus carabanensis (carabao) ORGANISM Bubalus carabanensis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bubalus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_073628) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_029407905.1-RS_2023_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/20/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1054 /organism="Bubalus carabanensis" /mol_type="mRNA" /isolate="K-KA32" /db_xref="taxon:346063" /chromosome="5" /sex="female" /tissue_type="blood" /dev_stage="heifer" /ecotype="Philippines" /collection_date="2021-10-28" /collected_by="Philippine Carabao Center" /breed="swamp buffalo" gene 1..1054 /gene="CCS" /note="copper chaperone for superoxide dismutase; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:129652284" CDS 138..884 /gene="CCS" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X4" /protein_id="XP_055436704.1" /db_xref="GeneID:129652284" /translation="
MASDSEDRGTACTLEFAVQMTCQSCVDAVRTSLQGIAGIQSVEVQLENQMVLVQTTLPSQEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILGGPGPVQGVVRFLQLTPERCLIEGTIDGLQPGLHGLHVHQFGDLTRNCNSCGDHFNPDGMSHGGPQDSERVWDVIGRSLVVDEGEDDLGRGGHPLSRITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGQGRKEPAQPPAHL"
polyA_site 1054 /gene="CCS" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
aaggagcagagccttgcgtgcgcgcgcagcggaaggcggggcaaggagtggcttccggggttccgcctccccctccccgcggcgcggctctgggctggcacttcagttccggccctcgggcgatagctggatccaggatggcttcggactcggaggaccgcgggactgcctgcacgctggagttcgcggtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggaatcgcaggcatccaaagtgtggaggtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagccaggaggtgcaggcccttctagaaggcactgggaggcaggcggtcctcaagggcatgggcagtggcctgttgcagaatttaggggcagccgtggccattctcggggggcctggccctgtgcagggagtggtgcgcttcctgcagctgacccctgagcgctgcctaatcgaggggaccattgatggcctgcagcctgggctgcatggactccacgtccatcagttcggggacctcacgaggaactgcaacagctgtggggaccactttaaccctgatggaatgtcccatgggggcccccaggactctgaacgggtgtgggatgtgattggccgaagcctggtcgtcgatgagggagaagatgacctgggccggggcgggcatcccttgtccaggatcacagggaactcaggagagaggttggcctgtggcatcatcgcacgctctgctggcctcttccagaaccccaagcagatctgctcctgtgatggcctcaccatctgggaggagcggggccggcccatcgctggccagggacggaaggagcctgcccagccccctgcccacctctgagcacggcctctgcctcgggtctgtcaccgtcctccctgctgagcaccgtccacttccagagggaggccctgctcacccagtcctgggagaaccagtgtgcaggctatgtttgatctcaaagggttgcttgctcttcccttggcaaattaaagttttattttcacatggaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]