2024-05-19 10:04:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_055217228 808 bp mRNA linear VRT 17-APR-2023 DEFINITION PREDICTED: Misgurnus anguillicaudatus protein PET117 homolog, mitochondrial (LOC129453150), transcript variant X2, mRNA. ACCESSION XM_055217228 VERSION XM_055217228.1 DBLINK BioProject: PRJNA955227 KEYWORDS RefSeq. SOURCE Misgurnus anguillicaudatus (oriental weatherfish) ORGANISM Misgurnus anguillicaudatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cobitidae; Cobitinae; Misgurnus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_073347) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_027580225.1-RS_2023_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/13/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..808 /organism="Misgurnus anguillicaudatus" /mol_type="mRNA" /isolate="BS_2022a" /db_xref="taxon:75329" /chromosome="11" /sex="female" /tissue_type="muscle" /dev_stage="adult" gene 1..808 /gene="LOC129453150" /note="protein PET117 homolog, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:129453150" CDS 113..361 /gene="LOC129453150" /codon_start=1 /product="protein PET117 homolog, mitochondrial" /protein_id="XP_055073203.1" /db_xref="GeneID:129453150" /translation="
MSTTSKVVLGVSIVLTISTVAGVHIKQNWDRQRLRDGVLRDLERVERKRENLRTLEEQIQLTRELVADRERREGDKTGTHTS"
polyA_site 808 /gene="LOC129453150" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
tctggcatacgaatgtaaacactacagaaacaattctgctcatcctgttaccaaagtaccctagccgaatattatcctgctgttgtttaaatcaaagtaatgctttttaattatgtctacgacctctaaggttgttctgggagtgtcgatagtcctcactatcagtaccgttgcaggcgttcatataaagcagaactgggacagacagaggctgcgcgacggagtgctgcgcgatctggagcgcgtggagcggaagcgcgagaacctgcgcacgctcgaggaacagatccagctgacgagagagctcgtggccgatcgagagagacgcgagggtgacaagacgggaacacacacttcataaactgaccatattaacgacatggatagcggggaccaaaggagccttgcggcacaggatgatgagaccatgtgcacgtctgcttctgagggtttggaggagggtgaggttgagggagaaactctgctcatcgtggagtctgaggaccaggcgtccgtggatctgtctcacgaccagagcggagactctctgaacagtgacgttggagaggatggagaggggagctggaacgaggacatgtcgttctattgcgacaagtgccacaagtggatcccgtctggtgagaagacgattcggctccggtaccagaagaacaggctgtcggctccatgtggccgatatgcactaatatgactacatcactatatctgttttataaacttaataatgatttcagagtaacatgtagtgcactttatgtctcaataaagactcgtcctgaaaggaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]