2024-05-18 22:17:07, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_055080245 255 bp mRNA linear MAM 14-APR-2023 DEFINITION PREDICTED: Physeter catodon non-histone chromosomal protein HMG-14-like (LOC102973125), mRNA. ACCESSION XM_055080245 VERSION XM_055080245.1 DBLINK BioProject: PRJNA434122 KEYWORDS RefSeq. SOURCE Physeter catodon (sperm whale) ORGANISM Physeter catodon Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea; Odontoceti; Physeteridae; Physeter. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041231.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_002837175.3-RS_2023_04 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 04/05/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..255 /organism="Physeter catodon" /mol_type="mRNA" /isolate="SW-GA" /db_xref="taxon:9755" /chromosome="18" /sex="female" /tissue_type="muscle" /dev_stage="adult" gene 1..255 /gene="LOC102973125" /note="non-histone chromosomal protein HMG-14-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins" /db_xref="GeneID:102973125" CDS 1..255 /gene="LOC102973125" /codon_start=1 /product="non-histone chromosomal protein HMG-14-like" /protein_id="XP_054936220.1" /db_xref="GeneID:102973125" /translation="
MPKKKVSSAEGAVKEEPKKRLARLSAKPAPAKVETKPKKAAGKDTSSDKKCKPKGKGGAKAKQAEMANQATKEDLPAENGETKN"
ORIGIN
atgcccaagaagaaggtcagctccgctgagggggcagtgaaggaggagcccaagaagagattggcaaggttgtcagctaaaccggctcctgcaaaagtggaaacgaagccaaaaaaggcagcaggaaaggatacatcttcagacaaaaagtgcaaaccaaagggaaaagggggagcaaaggcaaaacaggctgaaatggctaaccaagcgactaaagaagacttacctgcagaaaatggagaaactaaaaactag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]