LOCUS       XM_054887428             621 bp    mRNA    linear   INV 03-APR-2023
DEFINITION  PREDICTED: Anastrepha obliqua uncharacterized LOC129248022
            (LOC129248022), mRNA.
ACCESSION   XM_054887428
VERSION     XM_054887428.1
DBLINK      BioProject: PRJNA950966
KEYWORDS    RefSeq.
SOURCE      Anastrepha obliqua
  ORGANISM  Anastrepha obliqua
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Tephritoidea; Tephritidae; Anastrepha.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_072896) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_027943255.1-RS_2023_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/31/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..621
                     /organism="Anastrepha obliqua"
                     /mol_type="mRNA"
                     /isolate="idAnaObli1"
                     /isolation_source="Lab colony established from wild flies
                     reared from red mombin fruits and maintained on mango."
                     /db_xref="taxon:95512"
                     /chromosome="5"
                     /sex="male"
                     /tissue_type="Whole body"
                     /dev_stage="adult"
                     /country="Colombia: Chagres, Valle del Cauca"
                     /collection_date="2020-03"
                     /collected_by="Sandra Marcela Velasco-Cuervo"
     gene            1..621
                     /gene="LOC129248022"
                     /note="uncharacterized LOC129248022; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:129248022"
     CDS             117..512
                     /gene="LOC129248022"
                     /codon_start=1
                     /product="uncharacterized protein LOC129248022"
                     /protein_id="XP_054743403.1"
                     /db_xref="GeneID:129248022"
                     /translation="

MDVISEINEKYSALEAEIDRRLDKIKMEEKKLEKLQEQRASKTSAQTTKVLSYEESLARNTNLLKSLEIAKARLRSRSTFSPVEQILEKAIANYKSDLETSQQLSSRFKQVQIYEASPMLGTAREDGVQLK"

ORIGIN      

gcagtgaattttcactcattttctatttattaagttacaaaaattaacataagtggccgatttgtacttctatacttacctctttacataaatatacgccagacgtagtattggaaatggatgtaatcagcgaaatcaatgaaaaatattccgcattggaggcagaaatcgacaggaggttggacaaaatcaaaatggaagaaaagaaattggaaaagttgcaagaacaaagagcgagcaaaacatcagcacaaactactaaagttctctcgtatgaggagtcacttgcgagaaatacaaatttgcttaagtcattggagatagccaaagcgcggttacgttcacgttcgactttctcgccagttgagcaaatactggaaaaggcaatagcaaactataagagcgacctggaaacgtcacagcaattatcgtcacgtttcaagcaagtgcaaatttatgaagcgtcacctatgctaggcactgccagagaagatggagtacaactgaagtgagtgcaagtgatgcacacacacgcacatatccacacgcatttttaagtacttatttaagtaatgtatcaacttgtacgcaaatgagatcatatttaataaaactgctgaa

//