2024-04-29 21:51:26, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_053736243 285 bp mRNA linear INV 16-FEB-2023 DEFINITION Caenorhabditis remanei uncharacterized protein (GCK72_025216), partial mRNA. ACCESSION XM_053736243 VERSION XM_053736243.1 DBLINK BioProject: PRJNA933661 BioSample: SAMN13028143 KEYWORDS RefSeq. SOURCE Caenorhabditis remanei ORGANISM Caenorhabditis remanei Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 285) AUTHORS Teterina,A.A., Willis,J.H. and Phillips,P.C. TITLE Chromosome-level assembly of the Caenorhabditis remanei genome JOURNAL Unpublished REFERENCE 2 (bases 1 to 285) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (13-FEB-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 285) AUTHORS Teterina,A.A., Willis,J.H. and Phillips,P.C. TITLE Direct Submission JOURNAL Submitted (19-DEC-2019) Institute of Ecology and Evolution, University of Oregon, 5289 University of Oregon, Eugene, OR 97403, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_071333). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..285 /organism="Caenorhabditis remanei" /mol_type="mRNA" /strain="PX506" /isolation_source="isopod" /db_xref="taxon:31234" /chromosome="X" /sex="pooled males and females" /tissue_type="whole organism" /dev_stage="mixed stage" /country="Canada: Toronto" gene <1..>285 /locus_tag="GCK72_025216" /db_xref="GeneID:78777891" CDS 1..285 /locus_tag="GCK72_025216" /codon_start=1 /product="hypothetical protein" /protein_id="XP_053579809.1" /db_xref="GeneID:78777891" /translation="
MSGNKSETTESGKTTLPHERLIEAYNRRFEIQEEIDVMTKTTDGYQSRKFDQLTMQLTYVDNIISIGESDFDKKRAATVGKLFAVLRTLQHSNN"
ORIGIN
atgtccggcaataaaagtgaaacgacagaaagtggaaaaactacgttgccgcatgaacgactgattgaagcatacaaccgaaggtttgaaattcaagaagagattgatgttatgaccaaaactacggatggctaccaatccaggaaatttgaccaattgacaatgcagctcacctatgttgacaatatcatctcaattggggagagcgactttgataagaaacgtgccgccaccgtgggaaagttgttcgctgtattgaggactctccaacattctaacaactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]