2024-05-20 05:00:26, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_053690020 608 bp mRNA linear VRT 04-MAR-2023 DEFINITION PREDICTED: Bombina bombina hepcidin-2 (LOC128638157), mRNA. ACCESSION XM_053690020 VERSION XM_053690020.1 DBLINK BioProject: PRJNA925521 KEYWORDS RefSeq. SOURCE Bombina bombina (fire-bellied toad) ORGANISM Bombina bombina Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Bombinatoridae; Bombina. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_069506) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_027579735.1-RS_2023_03 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 03/03/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..608 /organism="Bombina bombina" /mol_type="mRNA" /isolate="aBomBom1" /db_xref="taxon:8345" /chromosome="8" /sex="male" /tissue_type="blood, muscle, kidney, liver" /dev_stage="adult" /country="Poland: Ksiaz Wielki" /lat_lon="50.433333 N 20.150000 E" /collection_date="2020-08" gene 1..608 /gene="LOC128638157" /note="hepcidin-2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:128638157" CDS 65..307 /gene="LOC128638157" /codon_start=1 /product="hepcidin-2" /protein_id="XP_053545995.1" /db_xref="GeneID:128638157" /translation="
MKSAVLCSLVILTIICHLSFSVSVMGNEMKYPADQLTKSEMDESNLLTTLLRTKRQSHLSICRYCCNCCKNKGCGLCCRT"
ORIGIN
tcaaattgtcacagttagcccagaagtcagaaactggacacacctgcaagatacataagagacaatgaaatctgcagttctctgctcacttgtgatcctcacaattatctgccatctaagcttctctgtctcagtgatggggaatgaaatgaaatatcctgcagaccaacttacaaaatctgagatggatgagtcaaatttgctgaccactcttctcagaaccaaacgtcagtcccacttgtctatctgtcggtactgctgtaactgttgcaagaacaaaggctgtggcctctgctgtcgcacataagtcaccagtacatagttataaacccttggtgccatcatctcaatgaagaatttataactgacacgtagcatcacagagctctggacacacaaactgcacagtccaaatccagtgacatggatgaagtgggactgtaataaaggaaaccaggactggattaattagtgcttaatacaatctgatctaagcaatctagtcacccagataaaaatggtttatctgtaaatactgaactttatttatttctcacacctacatgattttactgcttctgtctatttatggttttttttccacttca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]