GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 05:00:26, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_053690020             608 bp    mRNA    linear   VRT 04-MAR-2023
DEFINITION  PREDICTED: Bombina bombina hepcidin-2 (LOC128638157), mRNA.
ACCESSION   XM_053690020
VERSION     XM_053690020.1
DBLINK      BioProject: PRJNA925521
KEYWORDS    RefSeq.
SOURCE      Bombina bombina (fire-bellied toad)
  ORGANISM  Bombina bombina
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Bombinatoridae; Bombina.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_069506) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_027579735.1-RS_2023_03
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 03/03/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..608
                     /organism="Bombina bombina"
                     /mol_type="mRNA"
                     /isolate="aBomBom1"
                     /db_xref="taxon:8345"
                     /chromosome="8"
                     /sex="male"
                     /tissue_type="blood, muscle, kidney, liver"
                     /dev_stage="adult"
                     /country="Poland: Ksiaz Wielki"
                     /lat_lon="50.433333 N 20.150000 E"
                     /collection_date="2020-08"
     gene            1..608
                     /gene="LOC128638157"
                     /note="hepcidin-2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:128638157"
     CDS             65..307
                     /gene="LOC128638157"
                     /codon_start=1
                     /product="hepcidin-2"
                     /protein_id="XP_053545995.1"
                     /db_xref="GeneID:128638157"
                     /translation="
MKSAVLCSLVILTIICHLSFSVSVMGNEMKYPADQLTKSEMDESNLLTTLLRTKRQSHLSICRYCCNCCKNKGCGLCCRT"
ORIGIN      
tcaaattgtcacagttagcccagaagtcagaaactggacacacctgcaagatacataagagacaatgaaatctgcagttctctgctcacttgtgatcctcacaattatctgccatctaagcttctctgtctcagtgatggggaatgaaatgaaatatcctgcagaccaacttacaaaatctgagatggatgagtcaaatttgctgaccactcttctcagaaccaaacgtcagtcccacttgtctatctgtcggtactgctgtaactgttgcaagaacaaaggctgtggcctctgctgtcgcacataagtcaccagtacatagttataaacccttggtgccatcatctcaatgaagaatttataactgacacgtagcatcacagagctctggacacacaaactgcacagtccaaatccagtgacatggatgaagtgggactgtaataaaggaaaccaggactggattaattagtgcttaatacaatctgatctaagcaatctagtcacccagataaaaatggtttatctgtaaatactgaactttatttatttctcacacctacatgattttactgcttctgtctatttatggttttttttccacttca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]