LOCUS       XM_051586729             454 bp    mRNA    linear   PLN 01-NOV-2022
DEFINITION  Umbelopsis ramanniana AG uncharacterized protein
            (K450DRAFT_227404), mRNA.
ACCESSION   XM_051586729
VERSION     XM_051586729.1
DBLINK      BioProject: PRJNA895890
            BioSample: SAMN02745731
KEYWORDS    RefSeq.
SOURCE      Umbelopsis ramanniana AG
  ORGANISM  Umbelopsis ramanniana AG
            Eukaryota; Fungi; Fungi incertae sedis; Mucoromycota;
            Mucoromycotina; Umbelopsidomycetes; Umbelopsidales;
            Umbelopsidaceae; Umbelopsis.
REFERENCE   1  (bases 1 to 454)
  AUTHORS   Amses,K.R., Simmons,D.R., Longcore,J.E., Mondo,S.J., Seto,K.,
            Jeronimo,G.H., Bonds,A.E., Quandt,C.A., Davis,W.J., Chang,Y.,
            Federici,B.A., Kuo,A., LaButti,K., Pangilinan,J., Andreopoulos,W.,
            Tritt,A., Riley,R., Hundley,H., Johnson,J., Lipzen,A., Barry,K.,
            Lang,B.F., Cuomo,C.A., Buchler,N.E., Grigoriev,I.V.,
            Spatafora,J.W., Stajich,J.E. and James,T.Y.
  TITLE     Diploid-dominant life cycles characterize the early evolution of
            Fungi
  JOURNAL   Proc Natl Acad Sci U S A 119 (36), e2116841119 (2022)
   PUBMED   36037379
REFERENCE   2  (bases 1 to 454)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (31-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 454)
  AUTHORS   Mondo,S.J., Amses,K.R., Simmons,D.R., Longcore,J.E., Seto,K.,
            Alves,G.H., Bonds,A.E., Quandt,C.A., Davis,W.J., Chang,Y.,
            Letcher,P.M., Powell,M.J., Kuo,A., Labutti,K., Pangilinan,J.,
            Andreopoulos,W., Tritt,A., Riley,R., Hundley,H., Johnson,J.,
            Lipzen,A., Barry,K., Berbee,M.L., Buchler,N.E., Grigoriev,I.V.,
            Spatafora,J.W., Stajich,J.E. and James,T.Y.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUN-2021) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_026252095).
            
            ##Metadata-START##
            Organism Display Name :: Umbelopsis ramanniana AG
            GOLD Stamp ID         :: Gp0046743
            ##Metadata-END##
FEATURES             Location/Qualifiers
     source          1..454
                     /organism="Umbelopsis ramanniana AG"
                     /mol_type="mRNA"
                     /strain="AG"
                     /db_xref="taxon:1314678"
                     /chromosome="Unknown"
     gene            1..454
                     /locus_tag="K450DRAFT_227404"
                     /db_xref="GeneID:75912077"
     CDS             62..400
                     /locus_tag="K450DRAFT_227404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_051447489.1"
                     /db_xref="GeneID:75912077"
                     /db_xref="JGIDB:Umbra1_227404"
                     /translation="

MSSSLFKHCSEHPLQADAARSTFVSSTRLARLLFFFFTPLQQALSSTIRVFSPDFASHSRFVGLPRVLLYKMTRGGELVMLGRPSRISRCSKRHHQYEPPKYRFLQIVNRNE"

ORIGIN      

ggcgataaatttgattggaaactggtcatatgggctgccaaacctggactgaaggtgaaagatgtcatcttccctgttcaaacattgcagcgaacaccctctgcaagcagacgctgctcggtcaacttttgtttcgtccacccgcctcgcacggcttcttttttttttttttacgccactacaacaagctctatcttccactattagagttttttctccagattttgcttcccatagcagatttgtcggcctgcctagggttctgctttataaaatgacccgaggtggagaactggttatgctgggtagaccgtcccgaatatccagatgtagtaaacgccaccaccaatatgagcccccaaaatatcgcttcctccaaattgtcaacagaaatgaatgaccttggtgcgaaaggccccaaagttttaaaactgcgctgaagtctgcttacgat

//