2024-05-19 15:21:36, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_051117821 1150 bp mRNA linear VRT 26-FEB-2023 DEFINITION PREDICTED: Labeo rohita ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5b (st6galnac5b), transcript variant X2, mRNA. ACCESSION XM_051117821 VERSION XM_051117821.1 DBLINK BioProject: PRJNA887821 KEYWORDS RefSeq. SOURCE Labeo rohita (rohu) ORGANISM Labeo rohita Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Labeoninae; Labeonini; Labeo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_066876) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_022985175.1-RS_2023_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/26/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1150 /organism="Labeo rohita" /mol_type="mRNA" /strain="BAU-BD-2019" /isolation_source="riverine" /db_xref="taxon:84645" /chromosome="8" /sex="male" /tissue_type="blood" /dev_stage="adult" gene 1..1150 /gene="st6galnac5b" /note="ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5b; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 24 Proteins" /db_xref="GeneID:127170062" CDS 6..737 /gene="st6galnac5b" /codon_start=1 /product="alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 5b" /protein_id="XP_050973778.1" /db_xref="GeneID:127170062" /translation="
MHCKSCALVTSSGHMTESGRGAEIDRKECVIRMNDAPTRGYQRDVGQRTSLRVVAHSSMQRVLRNRHELLNSSQNTTFIFWGPGNYMRQDGKGLVYNNLRLLKQMMPKLQIYVISKLKMLHFDELFKKETGKDRKRSNSWLSTGWFTMAIALEICDRINVYGMISPEFCKLPNLEPSVPYHYYEPAGPDECKMYLSHEQGRHGSHHRFITEKRVFANWARMFNIHFYQPDWRPAPVAQNSTDS"
misc_feature 9..611 /gene="st6galnac5b" /note="Glycosyltransferase family 29 (sialyltransferase); Region: Glyco_transf_29; pfam00777" /db_xref="CDD:425864" polyA_site 1150 /gene="st6galnac5b" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
ttaggatgcattgcaaaagctgtgccttagtgaccagctctggccacatgaccgaaagtggtcgaggtgcggagatcgaccgcaaggagtgcgttatccgtatgaacgacgccccaacacgaggctaccagagggacgtgggccagcgaacgagtctgcgtgtggtcgcacattccagcatgcaacgtgtgctacgaaaccgccacgagctgctcaactccagccagaacaccacatttatcttctgggggccgggaaactacatgcgacaagacggtaaaggccttgtctacaacaacctgcgtctgctgaagcagatgatgcctaaactacagatttacgtcatctcgaagctgaagatgctgcattttgatgagctttttaaaaaggaaacaggaaaagatagaaaaaggtccaattcatggctcagcacaggttggttcactatggcgattgcattggagatttgtgacagaatcaacgtctatggcatgatttcacctgagttctgcaagttgcccaacctcgagccctcagtgccgtatcactactacgagcctgcggggccagatgaatgtaaaatgtatctctcccacgagcagggccggcacggcagccaccaccgtttcatcacagagaaacgtgtctttgccaactgggctcgtatgttcaacatacacttctatcaaccggactggagaccggcacctgtagcacagaacagcacagactcatgaggttcaaacactgggctgtttctgggactcggagactttgtgtccttttaaggacaaatggatttgaacgtttgaactggaacacattatgaatgaaagtctattatgatgttatttgaggattgaaaagcaacgactttaattcaaggcttatgggagctgctctggcctaatgggatatcatgctatgagttctgcttattcgcagtggccagtgaatgtgcctagcacaacaacgactgtccctcaggaagtctagggaaattggagggctttaaaggacgcggaagtctgtaaatgaggctggcctttgattctgctctgctgccttctactgtaatcagtcacccgaggcaacaccgtgattacggatgaccttggatcaggcaggaggcctgaataaaataaacgtg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]