2024-05-19 06:53:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_050700771 1050 bp mRNA linear INV 21-SEP-2022 DEFINITION PREDICTED: Spodoptera frugiperda uncharacterized LOC126911824 (LOC126911824), mRNA. ACCESSION XM_050700771 VERSION XM_050700771.1 DBLINK BioProject: PRJNA849517 KEYWORDS RefSeq. SOURCE Spodoptera frugiperda (fall armyworm) ORGANISM Spodoptera frugiperda Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Noctuoidea; Noctuidae; Amphipyrinae; Spodoptera. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_064230) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: Spodoptera frugiperda Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1050 /organism="Spodoptera frugiperda" /mol_type="mRNA" /isolate="SF20-4" /db_xref="taxon:7108" /chromosome="19" /tissue_type="whole larval tissue" /country="Australia" /collection_date="2020-10" gene 1..1050 /gene="LOC126911824" /note="uncharacterized LOC126911824; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:126911824" CDS 74..943 /gene="LOC126911824" /codon_start=1 /product="uncharacterized protein LOC126911824" /protein_id="XP_050556728.1" /db_xref="GeneID:126911824" /translation="
MAKGTVIWLSVLFLGTVLGQPCPQPDPQFPCPCPAPEPAPCSPCDGAAQQIGPCNPCEPPVNYVYGQAPCGSILIRPGQIRFPTPPPIIVRPGEIRLPTPPAIWVKPAPVQPPAPQPITVRPPPVQPPTPAPFYVRVPAVNPPQPPPLIVRPPPVAVPRPPPMRVQPPAVQPPVPDALVVRPPKIVVPAPPTICFKPNPPQNFRTLGSATVCRLSNQNDGGSPCSCCPPPCPPCPPPCPCPCPPPCPPPCVPPCPCPCPCPCPCPCPCPPPCPPPCPCPCPCPPPPCIC"
polyA_site 1050 /gene="LOC126911824" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
aaatctaagatggcggcttgtctagggtataaaagacgcaatatcttccaaattaatatcagacgatcgaaaaatggcaaagggcacagtcatatggttatcggttctattcctgggcacagtactgggacagccgtgcccgcagccggacccgcagtttccctgcccctgcccagccccggagcctgccccctgcagcccctgcgatggggcagcccaacagattggcccctgcaacccgtgtgagccgccggtcaattatgtctacggtcaggcaccttgtggttcaatcctaatcaggccaggacagatccggttcccaacgccacccccgatcatagtccgccccggagagattaggctgcccacaccccccgcgatctgggtcaaacctgcccccgtgcagcccccagcgccgcagcccattactgtccgcccaccgcccgtgcagccgccgactcctgcccccttctacgtgagggtgccggctgtgaacccaccacaaccacccccattgatcgtccgacctcctccagtggctgtgccaagaccaccaccgatgagggtacaaccaccagcagtccagccgccagtaccagacgcactagtcgtgcgaccgccgaagatcgtcgtccccgcaccccctaccatctgcttcaagccaaaccccccacagaacttcaggaccttgggatcagccaccgtttgccgtctatccaaccagaatgatgggggatcaccttgttcttgctgtccccccccgtgtcccccctgtccccctccttgcccgtgtccatgtcctcccccttgtccaccaccgtgcgtccccccttgtccgtgcccgtgcccgtgtccgtgtccgtgcccgtgcccgtgtcccccaccgtgtcccccgccttgcccgtgcccgtgcccatgccccccacccccctgcatatgctagatttatgtaacaatttaatatatatgtatttgtatgtatataatatataacggtatacatttgtaattgattgagcgttttgaaatatagtgcgggttatttgagca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]